4yc7

Crystal structure of human FMNL2 GBD-FH3 Domains bound to Cdc42-GppNHp

Method: X-RAY DIFFRACTION D_max: 83.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Formin-like protein 2

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–379	Fragment：UNP residues 1-379	Cell division control protein 42 homolog × 1 （P60953） GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；20 mM Tris/HCl (pH 8.0), 14% (v/v) PEG 3350, 0.25 M magnesium acetate	Resolution 2.50 Å R-free 0.253

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	FMNL2_HUMAN
Isoform	Q96PY5-3
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 3–381； UniProt 1–379

Cell division control protein 42 homolog

Homo sapiens

UniProt P60953

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–179	Fragment：UNP residues 1-179	Formin-like protein 2 × 1 （Q96PY5） GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；20 mM Tris/HCl (pH 8.0), 14% (v/v) PEG 3350, 0.25 M magnesium acetate	Resolution 2.50 Å R-free 0.253

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4YC7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A4R G12V MUTANT OF HUMAN PLACENTAL CDC42 GTPASE IN THE GDP FORM Deposited 1998-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–191（191 aa） Chain B 1–191（191 aa）	Mutation：YES Mutation：YES	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 GNH AMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 2.50 Å R-free 0.280
1AJE CDC42 FROM HUMAN, NMR, 20 STRUCTURES Deposited 1997-05-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–187（187 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；298 K	Resolution not provided
1AM4 COMPLEX BETWEEN CDC42HS.GMPPNP AND P50 RHOGAP (H. SAPIENS) Deposited 1997-06-22	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2–177（176 aa）	Mutation：M501P	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.9；pH 5.9	Resolution 2.70 Å R-free 0.280
1AM4 COMPLEX BETWEEN CDC42HS.GMPPNP AND P50 RHOGAP (H. SAPIENS) Deposited 1997-06-22	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 2–177（176 aa）	Mutation：M501P	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.9；pH 5.9	Resolution 2.70 Å R-free 0.280
1AM4 COMPLEX BETWEEN CDC42HS.GMPPNP AND P50 RHOGAP (H. SAPIENS) Deposited 1997-06-22	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2–177（176 aa）	Mutation：M501P	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.9；pH 5.9	Resolution 2.70 Å R-free 0.280
1AN0 CDC42HS-GDP COMPLEX Deposited 1997-06-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–190（189 aa） Chain B 2–190（189 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.8；pH 4.8	Resolution 2.80 Å R-free 0.344
1CEE SOLUTION STRUCTURE OF CDC42 IN COMPLEX WITH THE GTPASE BINDING DOMAIN OF WASP Deposited 1999-03-08	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–179（179 aa） Fragment：CDC42	Not recorded	MG MAGNESIUM ION × 1 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 50mM；Pressure 1	Resolution not provided
1CF4 CDC42/ACK GTPASE-BINDING DOMAIN COMPLEX Deposited 1999-03-23	Different construct Different mutation/modification Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–191（191 aa）	Mutation：Q61L	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	SOLUTION NMR NMR measurement conditions pH 5.5；298 K NMR sample composition [50%2H; 100%15N,13C]-labelled Cdc42, unlabelled f-ACK, 90% H2O/10% \| 90% H2O/10% D2O NMR sample composition [U-15N] f-ACK, Cdc42, 90% H2O/10% \| 90% H2O/10% D2O NMR sample composition [U-13C; U-15N] f-ACK, Cdc42, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition [U-13C; U-15N] Cdc42, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition [U-100% 15N] Cdc42, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
1DOA Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi Deposited 1999-12-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–188（188 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1 GER GERAN-8-YL GERAN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；15% PEG 4000, 100 mM Glutamic Acid, 25 mM MgSO4, 50 mM Tris, 2 mM NaN3, 2 mM LDAO , pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 18K, temperature 291K	Resolution 2.60 Å R-free 0.320
1DOA Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi Deposited 1999-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–188（188 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 3 GER GERAN-8-YL GERAN × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；15% PEG 4000, 100 mM Glutamic Acid, 25 mM MgSO4, 50 mM Tris, 2 mM NaN3, 2 mM LDAO , pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 18K, temperature 291K	Resolution 2.60 Å R-free 0.320
1E0A Cdc42 complexed with the GTPase binding domain of p21 activated kinase Deposited 2000-03-16	Different construct Different mutation/modification Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Fragment：1-184	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	SOLUTION NMR NMR measurement conditions pH 5.5；298 K；Ionic strength (raw mmCIF value) 5 MM NA2HPO4, 25MM NACL；Pressure 1 NMR sample composition 90% WATER, 10% D2O	Resolution not provided
1EES SOLUTION STRUCTURE OF CDC42HS COMPLEXED WITH A PEPTIDE DERIVED FROM P-21 ACTIVATED KINASE, NMR, 20 STRUCTURES Deposited 2000-02-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–178（178 aa） Fragment：AMINO ACIDS 1-178	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；298 K；Ionic strength (raw mmCIF value) 64 mM；Pressure ambient NMR sample composition 0.8 mM U-15N,13C Cdc42Hs, 0.8 mM PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 90% H2O/10% D2O NMR sample composition 0.8 mM U-15N Cdc42Hs, 0.8 mM PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 90% H2O/10% D2O NMR sample composition 0.8 mM Cdc42Hs, 0.8 mM U-15N,13C PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 90% H2O/10% D2O NMR sample composition 0.8 mM Cdc42Hs, 0.8 mM U-15N PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 90% H2O/10% D2O NMR sample composition 0.8 mM 70%-2H,U-15N,13C Cdc42Hs, 0.8 mM PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 90% H2O/10% D2O NMR sample composition 0.8 mM U-2H,15N Cdc42Hs, 0.8 mM PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 90% H2O/10% D2O NMR sample composition 0.8 mM U-15N,13C Cdc42Hs, 0.8 mM PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 100% D2O NMR sample composition 0.8 mM Cdc42Hs, 0.8 mM U-15N,13C PBD46; 25 mM NaCl, 5 mM Na2PO4, 5 mM MgCl2, 1 mM NaN3, pH 5.5 \| 100% D2O	Resolution not provided
1GRN CRYSTAL STRUCTURE OF THE CDC42/CDC42GAP/ALF3 COMPLEX. Deposited 1998-07-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–191（191 aa） Fragment：CDC42	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 AF3 ALUMINUM FLUORIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.0	Resolution 2.10 Å R-free 0.259
1KI1 Guanine Nucleotide Exchange Region of Intersectin in Complex with Cdc42 Deposited 2001-12-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–188（188 aa） Fragment：residues 1-188	Mutation：C188S	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG 4000, ammonium sulfate, Tris, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.247
1KI1 Guanine Nucleotide Exchange Region of Intersectin in Complex with Cdc42 Deposited 2001-12-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–188（188 aa） Fragment：residues 1-188	Mutation：C188S	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG 4000, ammonium sulfate, Tris, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.247
1KZ7 Crystal Structure of the DH/PH Fragment of Murine Dbs in Complex with the Placental Isoform of Human Cdc42 Deposited 2002-02-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–188（188 aa） Fragment：residues 1-188	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；PEG 8000, sodium formate, Tris HCL, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.40 Å R-free 0.239
1KZ7 Crystal Structure of the DH/PH Fragment of Murine Dbs in Complex with the Placental Isoform of Human Cdc42 Deposited 2002-02-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–188（188 aa） Fragment：residues 1-188	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；PEG 8000, sodium formate, Tris HCL, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.40 Å R-free 0.239
1KZG DbsCdc42(Y889F) Deposited 2002-02-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–188（188 aa） Fragment：residues 1-188	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；PEG 8000,Tris HCL, NaFormate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.60 Å R-free 0.259
1KZG DbsCdc42(Y889F) Deposited 2002-02-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–188（188 aa） Fragment：residues 1-188	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；PEG 8000,Tris HCL, NaFormate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.60 Å R-free 0.259
1NF3 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6 Deposited 2002-12-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–181（180 aa）	Mutation：Q61L	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；24% PEG 4000, 100mM sodium citrate, 0.2M ammonium acetate, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.10 Å R-free 0.273
1NF3 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6 Deposited 2002-12-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–181（180 aa）	Mutation：Q61L	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；24% PEG 4000, 100mM sodium citrate, 0.2M ammonium acetate, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.10 Å R-free 0.273
1NF3 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6 Deposited 2002-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2–181（180 aa） Chain B 2–181（180 aa）	Mutation：Q61L Mutation：Q61L	MG MAGNESIUM ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；24% PEG 4000, 100mM sodium citrate, 0.2M ammonium acetate, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.10 Å R-free 0.273
2ASE NMR structure of the F28L mutant of Cdc42Hs Deposited 2005-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–178（178 aa）	Mutation：F28L	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；298 K；Ionic strength (raw mmCIF value) 30 mM；Pressure ambient NMR sample composition U-15N Cdc42Hs, 25 mM phosphate buffer, 5 mM MgCl2, pH 5.5, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition U-15N Cdc42Hs, 25 mM phosphate buffer, 5 mM MgCl2, pH 5.5, 100% D2O \| 100% D2O NMR sample composition Cdc42Hs, 25 mM phosphate buffer, 5 mM MgCl2, pH 5.5, 100% D2O \| 100% D2O	Resolution not provided
2DFK Crystal structure of the CDC42-Collybistin II complex Deposited 2006-03-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–191（191 aa）	Not recorded	GOL GLYCEROL × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；PEG 8000, Potassium dihydrogen phosphate, NaCl, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K, pH 8.00	Resolution 2.15 Å R-free 0.229
2DFK Crystal structure of the CDC42-Collybistin II complex Deposited 2006-03-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–191（191 aa）	Not recorded	GOL GLYCEROL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；PEG 8000, Potassium dihydrogen phosphate, NaCl, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K, pH 8.00	Resolution 2.15 Å R-free 0.229
2DFK Crystal structure of the CDC42-Collybistin II complex Deposited 2006-03-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–191（191 aa） Chain D 1–191（191 aa）	Not recorded	GOL GLYCEROL × 6 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；PEG 8000, Potassium dihydrogen phosphate, NaCl, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K, pH 8.00	Resolution 2.15 Å R-free 0.229
2KB0 Cdc42(T35A) Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–178（178 aa）	Mutation：T35A	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；298 K；Pressure ambient NMR sample composition 0.4 mM [U-100% 13C; U-100% 15N] Cdc42(T35A), 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2NGR TRANSITION STATE COMPLEX FOR GTP HYDROLYSIS BY CDC42: COMPARISONS OF THE HIGH RESOLUTION STRUCTURES FOR CDC42 BOUND TO THE ACTIVE AND CATALYTICALLY COMPROMISED FORMS OF THE CDC42-GAP. Deposited 1998-07-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–191（191 aa） Fragment：FULL-LENGTH CDC42 IN COMPLEX WITH A C-TERMINAL ACTIVE DOMAIN OF CDC42GAP(R305A) MUTANT.	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 AF3 ALUMINUM FLUORIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.0	Resolution 1.90 Å R-free 0.293
2ODB The crystal structure of human cdc42 in complex with the CRIB domain of human p21-activated kinase 6 (PAK6) Deposited 2006-12-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–181（181 aa）	Not recorded	CL CHLORIDE ION × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 3 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；0.1M acetate, 2M (NH4)2SO4, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.232
2ODB The crystal structure of human cdc42 in complex with the CRIB domain of human p21-activated kinase 6 (PAK6) Deposited 2006-12-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–181（181 aa）	Not recorded	CL CHLORIDE ION × 2 MG MAGNESIUM ION × 2 SO4 SULFATE ION × 6 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；0.1M acetate, 2M (NH4)2SO4, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.232
2ODB The crystal structure of human cdc42 in complex with the CRIB domain of human p21-activated kinase 6 (PAK6) Deposited 2006-12-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–181（181 aa）	Not recorded	CL CHLORIDE ION × 2 MG MAGNESIUM ION × 2 SO4 SULFATE ION × 6 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；0.1M acetate, 2M (NH4)2SO4, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.232
2ODB The crystal structure of human cdc42 in complex with the CRIB domain of human p21-activated kinase 6 (PAK6) Deposited 2006-12-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–181（181 aa）	Not recorded	CL CHLORIDE ION × 2 MG MAGNESIUM ION × 2 SO4 SULFATE ION × 6 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；0.1M acetate, 2M (NH4)2SO4, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.232
2QRZ Cdc42 bound to GMP-PCP: Induced Fit by Effector is Required Deposited 2007-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–189（189 aa） Chain B 1–189（189 aa）	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 1 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；12% PEG 6K, 100 mM Na Acetate, 50 mM MES, pH 6.0, 100 mM Ammonium Sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.40 Å R-free 0.263
2WM9 Structure of the complex between DOCK9 and Cdc42. Deposited 2009-06-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–188（188 aa）	Not recorded	GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；THE PROTEIN WAS CONCENTRATED TO 6 MG/ML. CRYSTALS WERE GROWN USING HANGING DROP VAPOUR DIFFUSION. 1 UL OF COMPLEX WITH 200 MM NDSB-201 ADDED TO PROTEIN PRIOR TO CRYSTALLIZATION WAS MIXED WITH EQUAL VOLUME OF CRYSTALLIZATION BUFFER: 14% (W/V) PEG3350,100 MM MES (PH 6.0), 200 MM AMMONIUM ACETATE, 12% GLYCEROL. CRYSTALS WERE GROWN AT 20C.	Resolution 2.20 Å R-free 0.251
2WMN Structure of the complex between DOCK9 and Cdc42-GDP. Deposited 2009-07-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–188（188 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.0	Resolution 2.39 Å R-free 0.276
2WMO Structure of the complex between DOCK9 and Cdc42. Deposited 2009-07-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–188（188 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.0	Resolution 2.20 Å R-free 0.272
3GCG crystal structure of MAP and CDC42 complex Deposited 2009-02-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–178（177 aa） Fragment：UNP residues 2-178	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes pH 7.5, 10% PEG 6000, 5% MPD, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.277
3QBV Structure of designed orthogonal interaction between CDC42 and nucleotide exchange domains of intersectin Deposited 2011-01-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–178（178 aa） Fragment：UNP Residues 1-178	Mutation：F56R	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；295 K；100mm TRIS pH 7.5, 25% PEG 3350, 150mm ammonium sulfate, and 1mM DTT, temperature 295k, VAPOR DIFFUSION, HANGING DROP	Resolution 2.65 Å R-free 0.284
3QBV Structure of designed orthogonal interaction between CDC42 and nucleotide exchange domains of intersectin Deposited 2011-01-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–178（178 aa） Fragment：UNP Residues 1-178	Mutation：F56R	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；295 K；100mm TRIS pH 7.5, 25% PEG 3350, 150mm ammonium sulfate, and 1mM DTT, temperature 295k, VAPOR DIFFUSION, HANGING DROP	Resolution 2.65 Å R-free 0.284
3VHL Crystal structure of the DHR-2 domain of DOCK8 in complex with Cdc42 (T17N mutant) Deposited 2011-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–188（188 aa）	Mutation：T17N, C188S	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；0.2M Potassium phosphate, 20% PEG 3350, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.08 Å R-free 0.232
4DID Crystal structure of Salmonella effector N-terminal domain SopB in complex with Cdc42 Deposited 2012-01-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–183（183 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；277 K；0.2M sodium chloride, 0.1M phosphate-citrate pH 4.2, 20% PEG 8000, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.35 Å R-free 0.237
4ITR Crystal Structure of IbpAFic2-H3717A in complex with adenylylated Cdc42 Deposited 2013-01-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–191（191 aa） Chain D 1–191（191 aa）	Not recorded	SO4 SULFATE ION × 4 AMP ADENOSINE MONOPHOSPHATE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277 K；PEG 3350, Bis-Tris, (NH4)2SO4, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 2.30 Å R-free 0.226
4JS0 Complex of Cdc42 with the CRIB-PR domain of IRSp53 Deposited 2013-03-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–178（178 aa）	Mutation：G12V	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 2 PE4 2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；18-20% PEG 4000, 0.2M magnesium chloride, 0.004M betain hydrochloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.199
4YDH The structure of human FMNL1 N-terminal domains bound to Cdc42 Deposited 2015-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–179（179 aa） Chain D 1–179（179 aa）	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；17% (v/v) PEG 3350, 0.16 M tri-ammonium citrate	Resolution 3.80 Å R-free 0.281
5FI1 Crystal Structure of the P-Rex1 DH/PH tandem in complex with Cdc42 Deposited 2015-12-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–191（191 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；294 K；Ammonium citrate, PEG 3350	Resolution 3.20 Å R-free 0.198
5HZK Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain in complex with Cdc42 Deposited 2016-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–188（188 aa）	Mutation：C188S	GDP GUANOSINE-5'-DIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；293 K；0.1 M MES, 20% (w/v) PEG 6000	Resolution 3.30 Å R-free 0.257
5HZK Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain in complex with Cdc42 Deposited 2016-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–188（188 aa）	Mutation：C188S	GDP GUANOSINE-5'-DIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；293 K；0.1 M MES, 20% (w/v) PEG 6000	Resolution 3.30 Å R-free 0.257
5UPK CDC42 binds PAK4 via an extended GTPase-effector interface - 3 peptide: PAK4cat, PAK4-N45, CDC42 Deposited 2017-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–177（177 aa）	Mutation：Q61L	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；295 K；0.1M HEPES pH 7.5, 22% PEG1,000	Resolution 2.40 Å R-free 0.264
5UPL CDC42 binds PAK4 via an extended GTPase-effector inteface - 2 peptide: PAK4FL, CDC42 - UNREFINED Deposited 2017-02-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–177（177 aa） Fragment：UNP residues 1-177	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；0.1M Tris-HCl pH 8.5, 50mM Na2SO4, 6% PEG6000	Resolution 3.00 Å R-free 0.310
6AJ4 Crystal structure of the DHR-2 domain of DOCK7 in complex with Cdc42 Deposited 2018-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350 and tri-potassium citrate monohydrate	Resolution 3.26 Å R-free 0.259
6AJ4 Crystal structure of the DHR-2 domain of DOCK7 in complex with Cdc42 Deposited 2018-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350 and tri-potassium citrate monohydrate	Resolution 3.26 Å R-free 0.259
6AJ4 Crystal structure of the DHR-2 domain of DOCK7 in complex with Cdc42 Deposited 2018-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350 and tri-potassium citrate monohydrate	Resolution 3.26 Å R-free 0.259
6AJ4 Crystal structure of the DHR-2 domain of DOCK7 in complex with Cdc42 Deposited 2018-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350 and tri-potassium citrate monohydrate	Resolution 3.26 Å R-free 0.259
6AJL DOCK7 mutant I1836Y complexed with Cdc42 Deposited 2018-08-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；PEG3350, tri-potassium citrate monohydrate	Resolution 3.23 Å R-free 0.259
6AJL DOCK7 mutant I1836Y complexed with Cdc42 Deposited 2018-08-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；PEG3350, tri-potassium citrate monohydrate	Resolution 3.23 Å R-free 0.259
6AJL DOCK7 mutant I1836Y complexed with Cdc42 Deposited 2018-08-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；PEG3350, tri-potassium citrate monohydrate	Resolution 3.23 Å R-free 0.259
6AJL DOCK7 mutant I1836Y complexed with Cdc42 Deposited 2018-08-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–188（188 aa）	Mutation：C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；PEG3350, tri-potassium citrate monohydrate	Resolution 3.23 Å R-free 0.259
6SIU Crystal structure of IbpAFic2 covalently tethered to Cdc42 Deposited 2019-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–191（191 aa） Chain D 1–191（191 aa）	Not recorded	SO4 SULFATE ION × 10 GDP GUANOSINE-5'-DIPHOSPHATE × 2 GOL GLYCEROL × 2 LJN [(2~{R},3~{S},4~{R},5~{R})-5-[4-(acetamidomethyl)-1,2,3-triazol-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl dihydrogen phosphate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292 K；1.6 M ammonium sulfate and 0.1 M citric acid	Resolution 2.49 Å R-free 0.239
6SUP Crystal Structure of TcdB2-TccC3-Cdc42 Deposited 2019-09-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 167–179（13 aa）	Not recorded	MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；293.15 K；0.1 M sodium chloride, 0.1 M magnesium chloride, 0.1 M tri-sodium citrate pH 5.5, 12 % PEG 4000 Seeding: 0.1 M magnesium chloride, 0.1 M tri-sodium acetate pH 4.6, 12 % PEG 6000	Resolution 2.00 Å R-free 0.320
6TKY Crystal structure of the DHR2 domain of DOCK10 in complex with CDC42 Deposited 2019-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–188（188 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；293 K；25% (w/v) PEG 3350, 200 mM potassium acetate, 8% (v/v) 1,1,1,3,3,3-Hexafluoro-2-propanol.	Resolution 2.55 Å R-free 0.246
6TKY Crystal structure of the DHR2 domain of DOCK10 in complex with CDC42 Deposited 2019-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–188（188 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；293 K；25% (w/v) PEG 3350, 200 mM potassium acetate, 8% (v/v) 1,1,1,3,3,3-Hexafluoro-2-propanol.	Resolution 2.55 Å R-free 0.246
6TKZ Crystal structure of the DHR2 domain of DOCK10 in complex with CDC42 Deposited 2019-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: dimeric	Chain C 1–188（188 aa） Chain D 1–188（188 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；293 K；25% (w/v) PEG 3350, 200 mM potassium acetate, 8% (v/v) 1,1,1,3,3,3-Hexafluoro-2-propanol.	Resolution 2.64 Å R-free 0.274
6TKZ Crystal structure of the DHR2 domain of DOCK10 in complex with CDC42 Deposited 2019-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: dimeric	Chain C 1–188（188 aa） Chain D 1–188（188 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；293 K；25% (w/v) PEG 3350, 200 mM potassium acetate, 8% (v/v) 1,1,1,3,3,3-Hexafluoro-2-propanol.	Resolution 2.64 Å R-free 0.274
7S0Y Structures of TcdB in complex with Cdc42 Deposited 2021-08-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 4–179（176 aa）	Not recorded	MN MANGANESE (II) ION × 1 UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 11 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.1 M sodium cacodylate (pH 6.6), 2.4 M ammonium sulfate, and 2.5% (v/v) Jeffamine M-600 (pH 7.0)	Resolution 2.79 Å R-free 0.259
8I5F Crystal structure of the DHR-2 domain of DOCK10 in complex with Cdc42 (T17N mutant) Deposited 2023-01-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–188（188 aa） Chain D 1–188（188 aa）	Mutation：T17N, C188S Mutation：T17N, C188S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；PEG 8000, sodium chloride	Resolution 2.80 Å R-free 0.296
9GRM Cdc42 in complex with inhibitory peptide Deposited 2024-09-11	Different construct Different mutation/modification Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Fragment：1-184	Mutation：Q61L	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	SOLUTION NMR NMR measurement conditions pH 6.8；298 K；Ionic strength (raw mmCIF value) 200；Pressure 1 NMR sample composition 0.48 mM [U-100% 15N] Cdc42, 0.58 mM None Peptide, 50 mM None sodium phosphate, 150 mM None sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.4 mM [U-13C; U-15N] Cdc42, 0.45 mM None Peptide, 50 mM None sodium phosphate, 150 mM None sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.415 mM [U-100% 15N] Peptide, 0.45 mM None Cdc42, 50 mM None sodium phosphate, 150 mM None sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9VM2 Structure of DOCK6-Cdc42 complex protomer Deposited 2025-06-27	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–187（187 aa）	Mutation：G15A	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.94 Å
9VM3 Structure of DOCK6-Cdc42 complex Deposited 2025-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–187（187 aa） Chain D 1–187（187 aa）	Mutation：G15A Mutation：G15A	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.52 Å

45 other PDB entries and 68 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CDC42_HUMAN
Isoform	P60953-1
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 3–181； UniProt 1–179

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4yc7
Deposition date deposition_date	2015-02-19
Structure title title	Crystal structure of human FMNL2 GBD-FH3 Domains bound to Cdc42-GppNHp
Keywords keywords	signaling protein, Armadillo repeat, Rho GTPase, cell cycle; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.22 Å
Radius of gyration Rg (electron density) rg_electron	24.20 Å
Forward intensity I(0) i0	49150100.00
Molecular weight molecular_weight	54663.0 kDa
Excluded volume excluded_volume	68620 Å³
Envelope volume envelope_volume	83779 Å³
Hydration-shell volume shell_volume	28389 Å³
Envelope diameter envelope_diameter	85.6 Å
Shell Rg shell_rg	31.82 Å
Envelope Rg envelope_rg	24.34 Å
Shape Rg shape_rg	24.19 Å
Total Rg total_rg	25.11 Å
Total atoms total_atoms	3840
Residues n_residues	470
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	83.5 Å
Rg (real space) rg_real	25.12 Å
Rg uncertainty (real space) rg_real_error	0.43 Å
I(0) (real space) i0_real	4.9150e+07
I(0) uncertainty (real space) i0_real_error	6.3500e+05
Rg (reciprocal space) rg_reciprocal	25.15 Å
I(0) (reciprocal space) i0_reciprocal	49150000.0000
Solution quality estimate total_estimate	0.8912
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	30.5 Å
Skewness Skewness skewness	0.186
Kurtosis Kurtosis kurtosis	-0.448
Angular range angular_range	— – 0.3150 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	11120000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.863; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.998

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Formin-like protein 2
Molecular weight formula_weight	44081.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	3908

GAMGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDFESVESTVESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Cell division control protein 42 homolog
Molecular weight formula_weight	20028.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

GAMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
Molecular weight formula_weight	522.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	man
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	63

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4yc7a1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.8 — G proteins

Domain ID domain_id	d4yc7a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	4yc7A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

8. Citations (1)

▶

Unit-cell length a length_a	91.094 Å
Unit-cell length b length_b	91.094 Å
Unit-cell length c length_c	144.275 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	43.400 Å
R factor r_factor	0.1964
R_work r_work	0.1935
R_free r_free	0.2534

fit	/app/data/saxs_computation/yc/4yc7/4yc7.fit
pddf	/app/data/pr_computation/yc/4yc7/4yc7.pr.out
profile	/app/data/saxs_computation/yc/4yc7/4yc7.dat

Crystal structure of human FMNL2 GBD-FH3 Domains bound to Cdc42-GppNHp

1. Protein Identity and Related Structures Protein Identity & Related Structures

Formin-like protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Cell division control protein 42 homolog

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)