5iv7

Cryo-electron microscopy structure of the star-shaped, hubless post-attachment T4 baseplate

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate wedge protein gp6

OrganismNot specified

UniProt P19060

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Baseplate wedge protein gp25 × 6 （P09425） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP06_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–660； UniProt 1–660 Author chain B； PDBConstruct 1–660； UniProt 1–660 Author chain BF； PDBConstruct 1–660； UniProt 1–660 Author chain BG； PDBConstruct 1–660； UniProt 1–660 Author chain EA； PDBConstruct 1–660； UniProt 1–660 Author chain EB； PDBConstruct 1–660； UniProt 1–660 Author chain Q； PDBConstruct 1–660； UniProt 1–660 Author chain R； PDBConstruct 1–660； UniProt 1–660 Author chain g； PDBConstruct 1–660； UniProt 1–660 Author chain h； PDBConstruct 1–660； UniProt 1–660 Author chain w； PDBConstruct 1–660； UniProt 1–660 Author chain x； PDBConstruct 1–660； UniProt 1–660

Baseplate wedge protein gp7

OrganismNot specified

UniProt P19061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Baseplate wedge protein gp25 × 6 （P09425） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP07_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–1032； UniProt 1–1032 Author chain CA； PDBConstruct 1–1032； UniProt 1–1032 Author chain EC； PDBConstruct 1–1032； UniProt 1–1032 Author chain S； PDBConstruct 1–1032； UniProt 1–1032 Author chain i； PDBConstruct 1–1032； UniProt 1–1032 Author chain y； PDBConstruct 1–1032； UniProt 1–1032

Baseplate wedge protein gp8

OrganismNot specified

UniProt P19062

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Baseplate wedge protein gp25 × 6 （P09425） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP08_BPT4
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AA； PDBConstruct 1–334； UniProt 1–334 Author chain CB； PDBConstruct 1–334； UniProt 1–334 Author chain CC； PDBConstruct 1–334； UniProt 1–334 Author chain D； PDBConstruct 1–334； UniProt 1–334 Author chain E； PDBConstruct 1–334； UniProt 1–334 Author chain ED； PDBConstruct 1–334； UniProt 1–334 Author chain EE； PDBConstruct 1–334； UniProt 1–334 Author chain T； PDBConstruct 1–334； UniProt 1–334 Author chain U； PDBConstruct 1–334； UniProt 1–334 Author chain j； PDBConstruct 1–334； UniProt 1–334 Author chain k； PDBConstruct 1–334； UniProt 1–334 Author chain z； PDBConstruct 1–334； UniProt 1–334

Baseplate wedge protein gp9

OrganismNot specified

UniProt P10927

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Baseplate wedge protein gp25 × 6 （P09425） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP09_BPT4
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AB； PDBConstruct 1–288； UniProt 1–288 Author chain AC； PDBConstruct 1–288； UniProt 1–288 Author chain AD； PDBConstruct 1–288； UniProt 1–288 Author chain CD； PDBConstruct 1–288； UniProt 1–288 Author chain CE； PDBConstruct 1–288； UniProt 1–288 Author chain CF； PDBConstruct 1–288； UniProt 1–288 Author chain EF； PDBConstruct 1–288； UniProt 1–288 Author chain EG； PDBConstruct 1–288； UniProt 1–288 Author chain F； PDBConstruct 1–288； UniProt 1–288 Author chain FA； PDBConstruct 1–288； UniProt 1–288 Author chain G； PDBConstruct 1–288； UniProt 1–288 Author chain H； PDBConstruct 1–288； UniProt 1–288 Author chain V； PDBConstruct 1–288； UniProt 1–288 Author chain W； PDBConstruct 1–288； UniProt 1–288 Author chain X； PDBConstruct 1–288； UniProt 1–288 Author chain l； PDBConstruct 1–288； UniProt 1–288 Author chain m； PDBConstruct 1–288； UniProt 1–288 Author chain n； PDBConstruct 1–288； UniProt 1–288

Baseplate wedge protein gp10

OrganismNot specified

UniProt P10928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp11 × 18 （P10929） Baseplate wedge protein gp25 × 6 （P09425） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP10_BPT4
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AE； PDBConstruct 1–602； UniProt 1–602 Author chain AF； PDBConstruct 1–602； UniProt 1–602 Author chain AG； PDBConstruct 1–602； UniProt 1–602 Author chain CG； PDBConstruct 1–602； UniProt 1–602 Author chain DA； PDBConstruct 1–602； UniProt 1–602 Author chain DB； PDBConstruct 1–602； UniProt 1–602 Author chain FB； PDBConstruct 1–602； UniProt 1–602 Author chain FC； PDBConstruct 1–602； UniProt 1–602 Author chain FD； PDBConstruct 1–602； UniProt 1–602 Author chain I； PDBConstruct 1–602； UniProt 1–602 Author chain J； PDBConstruct 1–602； UniProt 1–602 Author chain K； PDBConstruct 1–602； UniProt 1–602 Author chain Y； PDBConstruct 1–602； UniProt 1–602 Author chain Z； PDBConstruct 1–602； UniProt 1–602 Author chain a； PDBConstruct 1–602； UniProt 1–602 Author chain o； PDBConstruct 1–602； UniProt 1–602 Author chain p； PDBConstruct 1–602； UniProt 1–602 Author chain q； PDBConstruct 1–602； UniProt 1–602

Baseplate wedge protein gp11

OrganismNot specified

UniProt P10929

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp25 × 6 （P09425） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP11_BPT4
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain BA； PDBConstruct 1–219； UniProt 1–219 Author chain BB； PDBConstruct 1–219； UniProt 1–219 Author chain BC； PDBConstruct 1–219； UniProt 1–219 Author chain DC； PDBConstruct 1–219； UniProt 1–219 Author chain DD； PDBConstruct 1–219； UniProt 1–219 Author chain DE； PDBConstruct 1–219； UniProt 1–219 Author chain FE； PDBConstruct 1–219； UniProt 1–219 Author chain FF； PDBConstruct 1–219； UniProt 1–219 Author chain FG； PDBConstruct 1–219； UniProt 1–219 Author chain L； PDBConstruct 1–219； UniProt 1–219 Author chain M； PDBConstruct 1–219； UniProt 1–219 Author chain N； PDBConstruct 1–219； UniProt 1–219 Author chain b； PDBConstruct 1–219； UniProt 1–219 Author chain c； PDBConstruct 1–219； UniProt 1–219 Author chain d； PDBConstruct 1–219； UniProt 1–219 Author chain r； PDBConstruct 1–219； UniProt 1–219 Author chain s； PDBConstruct 1–219； UniProt 1–219 Author chain t； PDBConstruct 1–219； UniProt 1–219

Baseplate wedge protein gp25

OrganismNot specified

UniProt P09425

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP25_BPT4
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain BD； PDBConstruct 1–132； UniProt 1–132 Author chain DF； PDBConstruct 1–132； UniProt 1–132 Author chain GA； PDBConstruct 1–132； UniProt 1–132 Author chain O； PDBConstruct 1–132； UniProt 1–132 Author chain e； PDBConstruct 1–132； UniProt 1–132 Author chain u； PDBConstruct 1–132； UniProt 1–132

Baseplate wedge protein gp53

OrganismNot specified

UniProt P16011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Baseplate wedge protein gp25 × 6 （P09425）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP53_BPT4
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain BE； PDBConstruct 1–196； UniProt 1–196 Author chain DG； PDBConstruct 1–196； UniProt 1–196 Author chain GB； PDBConstruct 1–196； UniProt 1–196 Author chain P； PDBConstruct 1–196； UniProt 1–196 Author chain f； PDBConstruct 1–196； UniProt 1–196 Author chain v； PDBConstruct 1–196； UniProt 1–196

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5iv7
Deposition date deposition_date	2016-03-19
Structure title title	Cryo-electron microscopy structure of the star-shaped, hubless post-attachment T4 baseplate
Keywords keywords	;T4, baseplate, post-attachment, bacteriophage, bacterial virus, star-shaped, hubless, membrane-piercing, cell attachment, infection, Viral protein ;; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5iv7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5iv7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5iv7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	177.40 Å
Total Rg	177.40 Å
Atom count	312210
Residues	39678
Excluded volume	5520700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5iv7__assembly_1__model_1`	96-meric （96）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Baseplate wedge protein gp6
Molecular weight formula_weight	74492.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,Q,R,g,h,w,x,BF,BG,EA,EB
Atom count atom_count	312210

MANTPVNYQLTRTANAIPEIFVGGTFAEIKQNLIEWLNGQNEFLDYDFEGSRLNVLCDLLAYNTLYIQQFGNAAVYESFMRTANLRSSVVQAAQDNGYLPTSKSAAQTEIMLTCTDALNRNYITIPRGTRFLAYAKDTSVNPYNFVSREDVIAIRDKNNQYFPRLKLAQGRIVRTEIIYDKLTPIIIYDKNIDRNQVKLYVDGAEWINWTRKSMVHAGSTSTIYYMRETIDGNTEFYFGEGEISVNASEGALTANYIGGLKPTQNSTIVIEYISTNGADANGAVGFSYADTLTNITVININENPNDDPDFVGADGGGDPEDIERIRELGTIKRETQQRCVTATDYDTFVSERFGSIIQAVQTFTDSTKPGYAFIAAKPKSGLYLTTVQREDIKNYLKDYNLAPITPSIISPNYLFIKTNLKVTYALNKLQESEQWLEGQIIDKIDRYYTEDVEIFNSSFAKSKMLTYVDDADHSVIGSSATIQMVREVQNFYKTPEAGIKYNNQIKDRSMESNTFSFNSGRKVVNPDTGLEEDVLYDVRIVSTDRDSKGIGKVIIGPFASGDVTENENIQPYTGNDFNKLANSDGRDKYYVIGEINYPADVIYWNIAKINLTSEKFEVQTIELYSDPTDDVIFTRDGSLIVFENDLRPQYLTIDLEPISQ

Entity 2 Entity 2 polymer

Description description	Baseplate wedge protein gp7
Molecular weight formula_weight	119336.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,S,i,y,CA,EC

MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLGYTANNSFFFDDADPLTTYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLANKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGSIQQVCKDINRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVYYQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYATLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNALIDFDPLSPTYSERLFEPDTMTITGNPKAVCYKMDSICDKVFALIIGEVETLNANPRTSKIIDSADKGIYVLNHDEKTWKRVFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQLIGAVKYEFPREWLADKHYHMMAFIADETSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAVVVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKASGEIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTMMPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRNIYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIVQSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLPSFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIAITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRIAKLTPTGEIEHDSVTGEAIYEPGPMAGVKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRLKDNIGNPRDPENPTQVKIDE

Entity 3 Entity 3 polymer

Description description	Baseplate wedge protein gp8
Molecular weight formula_weight	38041.7 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,T,U,j,k,z,AA,CB,CC,ED,EE

MNDSSVIYRAIVTSKFRTEKMLNFYNSIGSGPDKNTIFITFGRSEPWSSNENEVGFAPPYPTDSVLGVTDMWTHMMGTVKVLPSMLDAVIPRRDWGDTRYPDPYTFRINDIVVCNSAPYNATESGAGWLVYRCLDVPDTGMCSIASLTDKDECLKLGGKWTPSARSMTPPEGRGDAEGTIEPGDGYVWEYLFEIPPDVSINRCTNEYIVVPWPEELKEDPTRWGYEDNLTWQQDDFGLIYRVKANTIRFKAYLDSVYFPEAALPGNKGFRQISIITNPLEAKAHPNDPNVKAEKDYYDPEDLMRHSGEMIYMENRPPIIMAMDQTEEINILFTF

Entity 4 Entity 4 polymer

Description description	Baseplate wedge protein gp9
Molecular weight formula_weight	31024.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,V,W,X,l,m,n,AB,AC,AD,CD,CE,CF,EF,EG,FA

MFIQEPKKLIDTGEIGNASTGDILFDGGNKINSDFNAIYNAFGDQRKMAVANGTGADGQIIHATGYYQKHSITEYATPVKVGTRHDIDTSTVGVKVIIERGELGDCVEFINSNGSISVTNPLTIQAIDSIKGVSGNLVVTSPYSKVTLRCISSDNSTSVWNYSIESMFGQKESPAEGTWNISTSGSVDIPLFHRTEYNMAKLLVTCQSVDGRKIKTAEINILVDTVNSEVISSEYAVMRVGNETEEDEIANIAFSIKENYVTATISSSTVGMRAAVKVIATQKIGVAQ

Entity 5 Entity 5 polymer

Description description	Baseplate wedge protein gp10
Molecular weight formula_weight	66281.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,Y,Z,a,o,p,q,AE,AF,AG,CG,DA,DB,FB,FC,FD

MKQNINIGNVVDDGTGDYLRKGGIKINENFDELYYELGDGDVPYSAGAWKTYNASSGQTLTAEWGKSYAINTSSGRVTINLPKGTVNDYNKVIRARDVFATWNVNPVTLVAASGDTIKGSAVPVEINVRFSDLELVYCAPGRWEYVKNKQIDKITSSDISNVARKEFLVEVQGQTDFLDVFRGTSYNVNNIRVKHRGNELYYGDVFSENSDFGSPGENEGELVPLDGFNIRLRQPCNIGDTVQIETFMDGVSQWRSSYTRRQIRLLDSKLTSKTSLEGSIYVTDLSTMKSIPFSAFGLIPGEPINPNSLEVRFNGILQELAGTVGMPLFHCVGADSDDEVECSVLGGTWEQSHTDYSVETDENGIPEILHFDSVFEHGDIINITWFNNDLGTLLTKDEIIDETDNLYVSQGPGVDISGDVNLTDFDKIGWPNVEAVQSYQRAFNAVSNIFDTIYPIGTIYENAVNPNNPVTYMGFGSWKLFGQGKVLVGWNEDISDPNFALNNNDLDSGGNPSHTAGGTGGSTSVTLENANLPATETDEEVLIVDENGSVIVGGCQYDPDESGPIYTKYREAKASTNSTHTPPTSITNIQPYITVYRWIRIA

Entity 6 Entity 6 polymer

Description description	Baseplate wedge protein gp11
Molecular weight formula_weight	23725.5 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,N,b,c,d,r,s,t,BA,BB,BC,DC,DD,DE,FE,FF,FG

MSLLNNKAGVISRLADFLGFRPKTGDIDVMNRQSVGSVTISQLAKGFYEPNIESAINDVHNFSIKDVGTIITNKTGVSPEGVSQTDYWAFSGTVTDDSLPPGSPITVLVFGLPVSATTGMTAIEFVAKVRVALQEAIASFTAINSYKDHPTDGSKLEVTYLDNQKHVLSTYSTYGITISQEIISESKPGYGTWNLLGAQTVTLDNQQTPTVFYHFERTA

Entity 7 Entity 7 polymer

Description description	Baseplate wedge protein gp25
Molecular weight formula_weight	15111.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,e,u,BD,DF,GA

MANINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLASSNRV

Entity 8 Entity 8 polymer

Description description	Baseplate wedge protein gp53
Molecular weight formula_weight	22990.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,f,v,BE,DG,GB

MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNYDPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAVLENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.77 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	5176

Cryo-electron microscopy structure of the star-shaped, hubless post-attachment T4 baseplate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate wedge protein gp6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp25

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp53

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5iv7__assembly_1__model_1

5iv7__assembly_1__model_1 | I(q)

5iv7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer