5khr

Model of human Anaphase-promoting complex/Cyclosome complex (APC15 deletion mutant) in complex with the E2 UBE2C/UBCH10 poised for ubiquitin ligation to substrate (APC/C-CDC20-substrate-UBE2C)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1944； UniProt 1–1944

Anaphase-promoting complex subunit 11

Homo sapiens

UniProt Q9NYG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC11_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–84； UniProt 1–84

Cell division cycle protein 23 homolog

Homo sapiens

UniProt Q9UJX2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC23_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–597； UniProt 1–597 Author chain P； PDBConstruct 1–597； UniProt 1–597

Anaphase-promoting complex subunit 16

Homo sapiens

UniProt Q96DE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC16_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–110； UniProt 1–110

Cell division cycle protein 27 homolog

Homo sapiens

UniProt P30260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC27_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–824； UniProt 1–824 Author chain H； PDBConstruct 1–824； UniProt 1–824

Anaphase-promoting complex subunit CDC26

Homo sapiens

UniProt Q8NHZ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC26_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–85； UniProt 1–85 Author chain W； PDBConstruct 1–85； UniProt 1–85

Anaphase-promoting complex subunit 4

Homo sapiens

UniProt Q9UJX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC4_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–808； UniProt 1–808

Cell division cycle protein 16 homolog

Homo sapiens

UniProt Q13042

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC16_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–620； UniProt 1–620 Author chain K； PDBConstruct 1–620； UniProt 1–620

Anaphase-promoting complex subunit 10

Homo sapiens

UniProt Q9UM13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC10_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–185； UniProt 1–185

Anaphase-promoting complex subunit 13

Homo sapiens

UniProt Q9BS18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC13_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain M； PDBConstruct 1–74； UniProt 1–74

Anaphase-promoting complex subunit 2

Homo sapiens

UniProt Q9UJX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANC2_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain N； PDBConstruct 1–822； UniProt 1–822

Anaphase-promoting complex subunit 5

Homo sapiens

UniProt Q9UJX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC5_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–755； UniProt 1–755

Ubiquitin-conjugating enzyme E2 C

Homo sapiens

UniProt O00762

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UBE2C_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–179； UniProt 1–179

Cell division cycle protein 20 homolog

Homo sapiens

UniProt Q12834

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） HSL1 peptide × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC20_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain R； PDBConstruct 1–499； UniProt 1–499

Anaphase-promoting complex subunit 7

Homo sapiens

UniProt Q9UJX3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 20 homolog × 1 （Q12834） HSL1 peptide × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC7_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain X； PDBConstruct 1–565； UniProt 35–599 Author chain Y； PDBConstruct 1–565； UniProt 35–599

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5khr
Deposition date deposition_date	2016-06-15
Structure title title	Model of human Anaphase-promoting complex/Cyclosome complex (APC15 deletion mutant) in complex with the E2 UBE2C/UBCH10 poised for ubiquitin ligation to substrate (APC/C-CDC20-substrate-UBE2C)
Keywords keywords	ubiquitination, cell cycle, protein complex, mitosis; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5khr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5khr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5khr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	73.35 Å
Rg (electron density)	73.16 Å
Total Rg	73.14 Å
Atom count	0
Residues	0
Excluded volume	1115400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5khr__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Anaphase-promoting complex subunit 1
Molecular weight formula_weight	216725.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	7936

MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Anaphase-promoting complex subunit 11
Molecular weight formula_weight	9854.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Cell division cycle protein 23 homolog
Molecular weight formula_weight	68921.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Anaphase-promoting complex subunit 16
Molecular weight formula_weight	11678.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Cell division cycle protein 27 homolog
Molecular weight formula_weight	91973.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Anaphase-promoting complex subunit CDC26
Molecular weight formula_weight	9794.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,W

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Anaphase-promoting complex subunit 4
Molecular weight formula_weight	93207.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVEKLDPELDSGGSLEVLFQG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Cell division cycle protein 16 homolog
Molecular weight formula_weight	71747.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Anaphase-promoting complex subunit 10
Molecular weight formula_weight	21282.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Anaphase-promoting complex subunit 13
Molecular weight formula_weight	8528.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Anaphase-promoting complex subunit 2
Molecular weight formula_weight	94023.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFEPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYEAGVYRLPKNCS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Anaphase-promoting complex subunit 5
Molecular weight formula_weight	85249.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQAELLKNDETKALEPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Ubiquitin-conjugating enzyme E2 C
Molecular weight formula_weight	20748.4 kDa
EC 编号 ec_number	2.3.2.23,2.3.2.24
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEPGGSGSLEVLFQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 polymer

Description description	Cell division cycle protein 20 homolog
Molecular weight formula_weight	54796.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 15 Entity 15 polymer

Description description	HSL1 peptide
Molecular weight formula_weight	3783.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

NKENEGPEYPTKIEXYLEEQKPKRAALSDITNS

Entity 16 Entity 16 polymer

Description description	Anaphase-promoting complex subunit 7
Molecular weight formula_weight	63204.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,Y

MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

▶

Resolution resolution	6.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	222697

Model of human Anaphase-promoting complex/Cyclosome complex (APC15 deletion mutant) in complex with the E2 UBE2C/UBCH10 poised for ubiquitin ligation to substrate (APC/C-CDC20-substrate-UBE2C)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 23 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 27 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit CDC26

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 16 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer