8tar

APC/C-CDH1-UBE2C-Ubiquitin-CyclinB-NTD

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1944； UniProt 1–1944

G2/mitotic-specific cyclin-B1

Homo sapiens

UniProt P14635

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCNB1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–12； UniProt 39–50

Anaphase-promoting complex subunit 11

Homo sapiens

UniProt Q9NYG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC11_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–84； UniProt 1–84

Anaphase-promoting complex subunit 15

Homo sapiens

UniProt P60006

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC15_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–56； UniProt 2–57

Anaphase-promoting complex subunit CDC26

Homo sapiens

UniProt Q8NHZ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC26_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–85； UniProt 1–85 Author chain W； PDBConstruct 1–85； UniProt 1–85

Anaphase-promoting complex subunit 16

Homo sapiens

UniProt Q96DE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC16_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–58； UniProt 51–108

Anaphase-promoting complex subunit 4

Homo sapiens

UniProt Q9UJX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC4_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–808； UniProt 1–808

Cell division cycle protein 27 homolog

Homo sapiens

UniProt P30260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC27_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–824； UniProt 1–824 Author chain P； PDBConstruct 1–824； UniProt 1–824

Cell division cycle protein 16 homolog

Homo sapiens

UniProt Q13042

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC16_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–620； UniProt 1–620 Author chain S； PDBConstruct 1–620； UniProt 1–620

Anaphase-promoting complex subunit 10

Homo sapiens

UniProt Q9UM13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC10_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–185； UniProt 1–185

Anaphase-promoting complex subunit 13

Homo sapiens

UniProt Q9BS18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC13_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–74； UniProt 1–74

Anaphase-promoting complex subunit 2

Homo sapiens

UniProt Q9UJX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANC2_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain N； PDBConstruct 1–822； UniProt 1–822

Anaphase-promoting complex subunit 5

Homo sapiens

UniProt Q9UJX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC5_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–755； UniProt 1–755

Ubiquitin-conjugating enzyme E2 C

Homo sapiens

UniProt O00762

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UBE2C_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Q； PDBConstruct 1–145； UniProt 29–173

Fizzy-related protein homolog

Homo sapiens

UniProt Q9UM11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FZR1_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain R； PDBConstruct 1–496； UniProt 1–496

Cell division cycle protein 23 homolog

Homo sapiens

UniProt Q9UJX2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC23_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain U； PDBConstruct 1–597； UniProt 1–597 Author chain V； PDBConstruct 1–597； UniProt 1–597

Anaphase-promoting complex subunit 7

Homo sapiens

UniProt Q9UJX3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） G2/mitotic-specific cyclin-B1 × 1 （P14635） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 27 homolog × 2 （P30260） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Ubiquitin-conjugating enzyme E2 C × 1 （O00762） Fizzy-related protein homolog × 1 （Q9UM11） Cell division cycle protein 23 homolog × 2 （Q9UJX2） ZINC ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC7_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Y； PDBConstruct 1–565； UniProt 35–599 Author chain Z； PDBConstruct 1–565； UniProt 35–599

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8tar
Deposition date deposition_date	2023-06-27
Structure title title	APC/C-CDH1-UBE2C-Ubiquitin-CyclinB-NTD
Keywords keywords	E3 RING Ligase, Ubiquitin Ligase, LIGASE, TRANSFERASE; TRANSFERASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8tar__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8tar__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8tar__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.10 Å
Rg (electron density)	75.88 Å
Total Rg	75.89 Å
Atom count	54010
Residues	8984
Excluded volume	495010 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8tar__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	Anaphase-promoting complex subunit 1
Molecular weight formula_weight	217566.1 kDa
Mutation mutation	;S202E, S286E, T291E, S313E, T316E, S317E, S334E, S341E, S343E, S355E, S362E, S372E, S377E, T537E, S547E, S555E, S569E, S688E, S699E, S916E, S1347E ;
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	54010

MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGEPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFEEQGGEPQNVATSSSLTAHLRSLSKGDEPVEEPFQNYSSIHSQSRSTSEPSLHSREPEISNMAALSRAHEPALGVHEFSGVQRFNIESHNQEPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSEPKPLSKLLGELDEVVLLEPVPELRDSSKLHDELYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLEPVIAPKKARPEETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFEFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKEPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	G2/mitotic-specific cyclin-B1
Molecular weight formula_weight	1284.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

LRPRTALGDIGN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Anaphase-promoting complex subunit 11
Molecular weight formula_weight	9854.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Anaphase-promoting complex subunit 15
Molecular weight formula_weight	6556.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

STLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	Anaphase-promoting complex subunit CDC26
Molecular weight formula_weight	9920.1 kDa
Mutation mutation	S51E, S52E, S82E
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,W

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLEEDPKSREQMINDRIGYKPQPKPNNRSSQFGELEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	Anaphase-promoting complex subunit 16
Molecular weight formula_weight	6764.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

ERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 7 Entity 7 polymer

Description description	Anaphase-promoting complex subunit 4
Molecular weight formula_weight	92303.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLEEEEAENQQAGAAALAPEIVIKVEKLDPELDS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 8 Entity 8 polymer

Description description	Cell division cycle protein 27 homolog
Molecular weight formula_weight	92519.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,P

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPEEVLTEEPQDTIELNRLNLESENSKYSLNTDSSVSYIDSAVIEPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALEPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKEVARIGQTGTKSVFSQEGNEREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDEETTKENEKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDELEITKLDSEIISEGKISTIEPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 9 Entity 9 polymer

Description description	Cell division cycle protein 16 homolog
Molecular weight formula_weight	71929.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,S

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDEEGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIEPPWDFREFEVEKQTAEETGLEPLEEERKTPDSRPSLEETFEIEMNESDMMLETSMSDHST

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 10 Entity 10 polymer

Description description	Anaphase-promoting complex subunit 10
Molecular weight formula_weight	21310.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MTEPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 11 Entity 11 polymer

Description description	Anaphase-promoting complex subunit 13
Molecular weight formula_weight	8528.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 12 Entity 12 polymer

Description description	Anaphase-promoting complex subunit 2
Molecular weight formula_weight	94149.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQEPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPAEPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDEEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFEPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYEAGVYRLPKNCS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 13 Entity 13 polymer

Description description	Anaphase-promoting complex subunit 5
Molecular weight formula_weight	85446.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELEERDEGERKMEKEELDVEVREEEVECSGPLSQKQAEFFLSQQAELLKNDETKALEPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHEVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 14 Entity 14 polymer

Description description	Ubiquitin-conjugating enzyme E2 C
Molecular weight formula_weight	16346.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 15 Entity 15 polymer

Description description	Fizzy-related protein homolog
Molecular weight formula_weight	55253.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 16 Entity 16 polymer

Description description	Cell division cycle protein 23 homolog
Molecular weight formula_weight	69075.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V

MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDEREEGKALLRQILQLRNQGEEPTTEVPAPFFLPASLSANNEPTRRVEPLNLSSVEP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 17 Entity 17 polymer

Description description	Anaphase-promoting complex subunit 7
Molecular weight formula_weight	63204.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z

MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 18 Entity 18 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	661289

APC/C-CDH1-UBE2C-Ubiquitin-CyclinB-NTD

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

G2/mitotic-specific cyclin-B1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit CDC26

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 27 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 16 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer