5khu

Model of human Anaphase-promoting complex/Cyclosome (APC15 deletion mutant), in complex with the Mitotic checkpoint complex (APC/C-CDC20-MCC) based on cryo EM data at 4.8 Angstrom resolution

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1944； UniProt 1–1944

Anaphase-promoting complex subunit 11

Homo sapiens

UniProt Q9NYG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC11_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–84； UniProt 1–84

Cell division cycle protein 23 homolog

Homo sapiens

UniProt Q9UJX2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC23_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–597； UniProt 1–597 Author chain P； PDBConstruct 1–597； UniProt 1–597

Anaphase-promoting complex subunit 16

Homo sapiens

UniProt Q96DE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC16_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–110； UniProt 1–110

Cell division cycle protein 27 homolog

Homo sapiens

UniProt P30260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC27_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–824； UniProt 1–824 Author chain H； PDBConstruct 1–824； UniProt 1–824

Anaphase-promoting complex subunit CDC26

Homo sapiens

UniProt Q8NHZ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC26_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–85； UniProt 1–85 Author chain W； PDBConstruct 1–85； UniProt 1–85

Anaphase-promoting complex subunit 4

Homo sapiens

UniProt Q9UJX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC4_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–808； UniProt 1–808

Cell division cycle protein 16 homolog

Homo sapiens

UniProt Q13042

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC16_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–620； UniProt 1–620 Author chain K； PDBConstruct 1–620； UniProt 1–620

Anaphase-promoting complex subunit 10

Homo sapiens

UniProt Q9UM13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC10_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–185； UniProt 1–185

Anaphase-promoting complex subunit 13

Homo sapiens

UniProt Q9BS18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC13_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain M； PDBConstruct 1–74； UniProt 1–74

Anaphase-promoting complex subunit 2

Homo sapiens

UniProt Q9UJX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANC2_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain N； PDBConstruct 1–822； UniProt 1–822

Anaphase-promoting complex subunit 5

Homo sapiens

UniProt Q9UJX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC5_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–755； UniProt 1–755

Mitotic checkpoint serine/threonine-protein kinase BUB1 beta

Homo sapiens

UniProt O60566

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUB1B_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–1050； UniProt 1–1050

Cell division cycle protein 20 homolog

Homo sapiens

UniProt Q12834

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC20_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain R； PDBConstruct 1–499； UniProt 1–499 Author chain S； PDBConstruct 1–499； UniProt 1–499

Mitotic spindle assembly checkpoint protein MAD2A

Homo sapiens

UniProt Q13257

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） unknown × 1 Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MD2L1_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain T； PDBConstruct 1–205； UniProt 1–205

Anaphase-promoting complex subunit 7

Homo sapiens

UniProt Q9UJX3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Cell division cycle protein 20 homolog × 2 （Q12834） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257） unknown × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC7_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain X； PDBConstruct 1–565； UniProt 35–599 Author chain Y； PDBConstruct 1–565； UniProt 35–599

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5khu
Deposition date deposition_date	2016-06-15
Structure title title	Model of human Anaphase-promoting complex/Cyclosome (APC15 deletion mutant), in complex with the Mitotic checkpoint complex (APC/C-CDC20-MCC) based on cryo EM data at 4.8 Angstrom resolution
Keywords keywords	inhibition, cell cycle, mitosis, conformational change; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5khu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5khu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5khu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.83 Å
Rg (electron density)	74.57 Å
Total Rg	74.56 Å
Atom count	0
Residues	0
Excluded volume	1187900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5khu__assembly_1__model_1`	23-meric （23）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Anaphase-promoting complex subunit 1
Molecular weight formula_weight	217580.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	8453

MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGEPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFEEQGGEPQNVATSSSLTAHLRSLSKGDEPVEEPFQNYSSIHSQSRSTSEPSLHSREPEISNMAALSRAHEPALGVHEFSGVQRFNIESHNQEPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSEPKPLSKLLGELDEVVLLEPVPELRDSSKLHDELYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLFVTCLMNMMGYQTDRLAWTRNFDFEGSLEPVIAPKKARPEETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFEFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKEPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Anaphase-promoting complex subunit 11
Molecular weight formula_weight	9854.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Cell division cycle protein 23 homolog
Molecular weight formula_weight	69075.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDEREEGKALLRQILQLRNQGEEPTTEVPAPFFLPASLSANNEPTRRVEPLNLSSVEP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Anaphase-promoting complex subunit 16
Molecular weight formula_weight	11678.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Cell division cycle protein 27 homolog
Molecular weight formula_weight	92519.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPEEVLTEEPQDTIELNRLNLESENSKYSLNTDSSVSYIDSAVIEPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALEPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKEVARIGQTGTKSVFSQEGNEREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDEETTKENEKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDELEITKLDSEIISEGKISTIEPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Anaphase-promoting complex subunit CDC26
Molecular weight formula_weight	9920.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,W

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLEEDPKSREQMINDRIGYKPQPKPNNRSSQFGELEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Anaphase-promoting complex subunit 4
Molecular weight formula_weight	92303.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLEEEEAENQQAGAAALAPEIVIKVEKLDPELDS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Cell division cycle protein 16 homolog
Molecular weight formula_weight	71929.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDEEGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIEPPWDFREFEVEKQTAEETGLEPLEEERKTPDSRPSLEETFEIEMNESDMMLETSMSDHST

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Anaphase-promoting complex subunit 10
Molecular weight formula_weight	21310.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MTEPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Anaphase-promoting complex subunit 13
Molecular weight formula_weight	8528.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Anaphase-promoting complex subunit 2
Molecular weight formula_weight	94149.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQEPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPAEPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDEEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFEPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYEAGVYRLPKNCS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Anaphase-promoting complex subunit 5
Molecular weight formula_weight	85446.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELEERDEGERKMEKEELDVEVREEEVECSGPLSQKQAEFFLSQQAELLKNDETKALEPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHEVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
Molecular weight formula_weight	120004.2 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILETRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTEAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKEPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVEICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLEIKKLEPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQEPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTEPGALLFQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 polymer

Description description	Cell division cycle protein 20 homolog
Molecular weight formula_weight	54796.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 15 Entity 15 polymer

Description description	Mitotic spindle assembly checkpoint protein MAD2A
Molecular weight formula_weight	23533.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 16 Entity 16 polymer

Description description	unknown
Molecular weight formula_weight	785.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

AARAALAAA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 17 Entity 17 polymer

Description description	Anaphase-promoting complex subunit 7
Molecular weight formula_weight	63386.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,Y

MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPEEGNEAEEPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

▶

Resolution resolution	4.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	268851

Model of human Anaphase-promoting complex/Cyclosome (APC15 deletion mutant), in complex with the Mitotic checkpoint complex (APC/C-CDC20-MCC) based on cryo EM data at 4.8 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 23 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 27 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit CDC26

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 16 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer