6tlj

Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the Mitotic checkpoint complex (APC/C-MCC) at 3.8 angstrom resolution

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1944； UniProt 1–1944

Anaphase-promoting complex subunit 11

Homo sapiens

UniProt Q9NYG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC11_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–84； UniProt 1–84

Cell division cycle protein 23 homolog

Homo sapiens

UniProt Q9UJX2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC23_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–597； UniProt 1–597 Author chain P； PDBConstruct 1–597； UniProt 1–597

Anaphase-promoting complex subunit 15

Homo sapiens

UniProt P60006

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC15_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–121； UniProt 1–121

Anaphase-promoting complex subunit 16

Homo sapiens

UniProt Q96DE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC16_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–110； UniProt 1–110

Cell division cycle protein 27 homolog

Homo sapiens

UniProt P30260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC27_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–824； UniProt 1–824 Author chain H； PDBConstruct 1–824； UniProt 1–824

Anaphase-promoting complex subunit CDC26

Homo sapiens

UniProt Q8NHZ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC26_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–85； UniProt 1–85 Author chain W； PDBConstruct 1–85； UniProt 1–85

Anaphase-promoting complex subunit 4

Homo sapiens

UniProt Q9UJX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC4_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–808； UniProt 1–808

Cell division cycle protein 16 homolog

Homo sapiens

UniProt Q13042

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC16_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–620； UniProt 1–620 Author chain K； PDBConstruct 1–620； UniProt 1–620

Anaphase-promoting complex subunit 10

Homo sapiens

UniProt Q9UM13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC10_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–185； UniProt 1–185

Anaphase-promoting complex subunit 13

Homo sapiens

UniProt Q9BS18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC13_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–74； UniProt 1–74

Anaphase-promoting complex subunit 2

Homo sapiens

UniProt Q9UJX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANC2_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain N； PDBConstruct 1–822； UniProt 1–822

Anaphase-promoting complex subunit 5

Homo sapiens

UniProt Q9UJX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC5_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–755； UniProt 1–755

Cell division cycle protein 20 homolog

Homo sapiens

UniProt Q12834

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC20_HUMAN
Isoform	—
PDB entities	14, 15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–374； UniProt 126–499 Author chain R； PDBConstruct 1–499； UniProt 1–499

Mitotic checkpoint serine/threonine-protein kinase BUB1 beta

Homo sapiens

UniProt O60566

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUB1B_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain S； PDBConstruct 1–1050； UniProt 1–1050

Anaphase-promoting complex subunit 7

Homo sapiens

UniProt Q9UJX3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Mitotic spindle assembly checkpoint protein MAD2A × 1 （Q13257）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC7_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain X； PDBConstruct 1–599； UniProt 1–599 Author chain Y； PDBConstruct 1–599； UniProt 1–599

Mitotic spindle assembly checkpoint protein MAD2A

Homo sapiens

UniProt Q13257

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	Anaphase-promoting complex subunit 1 × 1 （Q9H1A4） Anaphase-promoting complex subunit 11 × 1 （Q9NYG5） Cell division cycle protein 23 homolog × 2 （Q9UJX2） Anaphase-promoting complex subunit 15 × 1 （P60006） Anaphase-promoting complex subunit 16 × 1 （Q96DE5） Cell division cycle protein 27 homolog × 2 （P30260） Anaphase-promoting complex subunit CDC26 × 2 （Q8NHZ8） Anaphase-promoting complex subunit 4 × 1 （Q9UJX5） Cell division cycle protein 16 homolog × 2 （Q13042） Anaphase-promoting complex subunit 10 × 1 （Q9UM13） Anaphase-promoting complex subunit 13 × 1 （Q9BS18） Anaphase-promoting complex subunit 2 × 1 （Q9UJX6） Anaphase-promoting complex subunit 5 × 1 （Q9UJX4） Cell division cycle protein 20 homolog × 1 （Q12834） Cell division cycle protein 20 homolog × 1 （Q12834） Mitotic checkpoint serine/threonine-protein kinase BUB1 beta × 1 （O60566） Anaphase-promoting complex subunit 7 × 2 （Q9UJX3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MD2L1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Z； PDBConstruct 1–205； UniProt 1–205

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6tlj
Deposition date deposition_date	2019-12-02
Structure title title	Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the Mitotic checkpoint complex (APC/C-MCC) at 3.8 angstrom resolution
Keywords keywords	E3 ligase, Complex, Mitotic checkpoint complex, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6tlj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6tlj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6tlj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.11 Å
Rg (electron density)	73.76 Å
Total Rg	73.92 Å
Atom count	72305
Residues	9200
Excluded volume	1290400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6tlj__assembly_1__model_1`	23-meric （23）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	Anaphase-promoting complex subunit 1
Molecular weight formula_weight	216775.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	72305

MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSFALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Anaphase-promoting complex subunit 11
Molecular weight formula_weight	9854.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Cell division cycle protein 23 homolog
Molecular weight formula_weight	68921.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Anaphase-promoting complex subunit 15
Molecular weight formula_weight	14286.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Anaphase-promoting complex subunit 16
Molecular weight formula_weight	11678.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Cell division cycle protein 27 homolog
Molecular weight formula_weight	91973.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Anaphase-promoting complex subunit CDC26
Molecular weight formula_weight	9794.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,W

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Anaphase-promoting complex subunit 4
Molecular weight formula_weight	92219.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVEKLDPELDS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Cell division cycle protein 16 homolog
Molecular weight formula_weight	71747.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Anaphase-promoting complex subunit 10
Molecular weight formula_weight	21282.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Anaphase-promoting complex subunit 13
Molecular weight formula_weight	8528.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Anaphase-promoting complex subunit 2
Molecular weight formula_weight	93939.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Anaphase-promoting complex subunit 5
Molecular weight formula_weight	85179.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 polymer

Description description	Cell division cycle protein 20 homolog
Molecular weight formula_weight	41226.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

EEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 15 Entity 15 polymer

Description description	Cell division cycle protein 20 homolog
Molecular weight formula_weight	54796.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 16 Entity 16 polymer

Description description	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
Molecular weight formula_weight	119682.0 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 17 Entity 17 polymer

Description description	Anaphase-promoting complex subunit 7
Molecular weight formula_weight	66929.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,Y

MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 18 Entity 18 polymer

Description description	Mitotic spindle assembly checkpoint protein MAD2A
Molecular weight formula_weight	23533.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

▼

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

Domain ID domain_id	6tljB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	40 — Herpes Virus-1
Homologous superfamily homologous superfamily	10 — Zinc/RING finger domain, C3HC4 (zinc finger)

Domain ID domain_id	6tljC01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	6tljC02
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	6tljJ01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	6tljK01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	6tljL00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	260 — Galactose-binding domain-like

Domain ID domain_id	6tljP01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	6tljP02
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	6tljQ01
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	6tljZ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	900 — Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A
Homologous superfamily homologous superfamily	10 — HORMA domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	343551

Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the Mitotic checkpoint complex (APC/C-MCC) at 3.8 angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 23 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 27 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit CDC26

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein 16 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer