5luf

Cryo-EM of bovine respirasome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain c； PDBConstruct 1–446； UniProt 35–480 Author chain l； PDBConstruct 1–446； UniProt 35–480

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P23004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain m； PDBConstruct 1–439； UniProt 15–453 Author chain n； PDBConstruct 1–439； UniProt 15–453

Cytochrome b

OrganismNot specified

UniProt P00157

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain b； PDBConstruct 1–379； UniProt 1–379 Author chain o； PDBConstruct 1–379； UniProt 1–379

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P00125

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–241； UniProt 85–325 Author chain p； PDBConstruct 1–241； UniProt 85–325

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P13272

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_BOVIN
Isoform	—
PDB entities	5, 9
Chains and sequence ranges	Author chain e； PDBConstruct 1–196； UniProt 79–274 Author chain q； PDBConstruct 1–196； UniProt 79–274 Author chain i； PDBConstruct 1–78； UniProt 1–78 Author chain u； PDBConstruct 1–78； UniProt 1–78

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt P00129

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–110； UniProt 2–111 Author chain r； PDBConstruct 1–110； UniProt 2–111

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt P13271

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain g； PDBConstruct 1–81； UniProt 2–82 Author chain s； PDBConstruct 1–81； UniProt 2–82

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P00126

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain h； PDBConstruct 1–78； UniProt 14–91 Author chain t； PDBConstruct 1–78； UniProt 14–91

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt P00130

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain j； PDBConstruct 1–62； UniProt 2–63 Author chain v； PDBConstruct 1–62； UniProt 2–63

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt P07552

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain k； PDBConstruct 1–56； UniProt 1–56 Author chain w； PDBConstruct 1–56； UniProt 1–56

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt P00396

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain x； PDBConstruct 1–514； UniProt 1–514

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P68530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_BOVIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain y； PDBConstruct 1–227； UniProt 1–227

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00415

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_BOVIN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain z； PDBConstruct 1–261； UniProt 1–261

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

OrganismNot specified

UniProt P00423

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX41_BOVIN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 1； PDBConstruct 1–147； UniProt 23–169

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00426

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_BOVIN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 2； PDBConstruct 1–109； UniProt 44–152

Cytochrome c oxidase subunit 5B, mitochondrial

OrganismNot specified

UniProt P00428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5B_BOVIN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 3； PDBConstruct 1–98； UniProt 32–129

Cytochrome c oxidase subunit 6A2, mitochondrial

OrganismNot specified

UniProt P07471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6A2_BOVIN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 4； PDBConstruct 1–84； UniProt 13–96

Cytochrome c oxidase subunit 6B1

OrganismNot specified

UniProt P00429

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6B1_BOVIN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 5； PDBConstruct 1–85； UniProt 2–86

Cytochrome c oxidase subunit 6C

OrganismNot specified

UniProt P04038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6C_BOVIN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 6； PDBConstruct 1–73； UniProt 2–74

Cytochrome c oxidase subunit 7A1, mitochondrial

OrganismNot specified

UniProt P07470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX7A1_BOVIN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 7； PDBConstruct 1–59； UniProt 22–80

Cytochrome c oxidase subunit 7B, mitochondrial

OrganismNot specified

UniProt P13183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7B_BOVIN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain 8； PDBConstruct 1–56； UniProt 25–80

Cytochrome c oxidase subunit 7C, mitochondrial

OrganismNot specified

UniProt P00430

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7C_BOVIN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 9； PDBConstruct 1–47； UniProt 17–63

Cytochrome c oxidase subunit 8B, mitochondrial

OrganismNot specified

UniProt P10175

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 complex I × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 3 COPPER (II) ION × 3 MAGNESIUM ION × 1 HEME-A × 2 ZINC ION × 1 IRON/SULFUR CLUSTER × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8B_BOVIN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 0； PDBConstruct 1–46； UniProt 25–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5luf
Deposition date deposition_date	2016-09-08
Structure title title	Cryo-EM of bovine respirasome
Keywords keywords	Mitochondria, supercomplex, respiratory chain, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5luf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5luf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5luf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	91.27 Å
Rg (electron density)	90.26 Å
Total Rg	90.08 Å
Atom count	74492
Residues	11467
Excluded volume	1288800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5luf__assembly_1__model_1`	62-meric （62）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (59)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	49266.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,l
Atom count atom_count	74493

TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	46575.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,n

SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42620.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,o

MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27323.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,p

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21640.6 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,q

SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13371.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,r

AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9606.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,s

GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	9189.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,t

GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	7964.3 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,u

MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7209.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,v

VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK

Entity 11 Entity 11 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	6370.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,w

MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPYINGKFKKDD

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	57065.8 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26040.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML

Entity 14 Entity 14 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	29943.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWHFVDVVWLFLYVSIYWWGS

Entity 15 Entity 15 polymer

Description description	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Molecular weight formula_weight	17179.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK

Entity 16 Entity 16 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	12453.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Entity 17 Entity 17 polymer

Description description	Cytochrome c oxidase subunit 5B, mitochondrial
Molecular weight formula_weight	10684.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH

Entity 18 Entity 18 polymer

Description description	Cytochrome c oxidase subunit 6A2, mitochondrial
Molecular weight formula_weight	9452.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK

Entity 19 Entity 19 polymer

Description description	Cytochrome c oxidase subunit 6B1
Molecular weight formula_weight	10039.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI

Entity 20 Entity 20 polymer

Description description	Cytochrome c oxidase subunit 6C
Molecular weight formula_weight	8495.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK

Entity 21 Entity 21 polymer

Description description	Cytochrome c oxidase subunit 7A1, mitochondrial
Molecular weight formula_weight	6682.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK

Entity 22 Entity 22 polymer

Description description	Cytochrome c oxidase subunit 7B, mitochondrial
Molecular weight formula_weight	6365.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ

Entity 23 Entity 23 polymer

Description description	Cytochrome c oxidase subunit 7C, mitochondrial
Molecular weight formula_weight	5449.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK

Entity 24 Entity 24 polymer

Description description	Cytochrome c oxidase subunit 8B, mitochondrial
Molecular weight formula_weight	4967.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA

Entity 25 Entity 25 polymer

Description description	complex I
Molecular weight formula_weight	9464.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 26 Entity 26 polymer

Description description	complex I
Molecular weight formula_weight	12260.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

XXXXXXXXXXXXXXXXXXXXXXXXXXXCCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXXXXXXXXXXXXXXXXXXX

Entity 27 Entity 27 polymer

Description description	complex I
Molecular weight formula_weight	13124.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 28 Entity 28 polymer

Description description	complex I
Molecular weight formula_weight	32698.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

Entity 29 Entity 29 polymer

Description description	complex I
Molecular weight formula_weight	13621.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 30 Entity 30 polymer

Description description	complex I
Molecular weight formula_weight	35068.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

Entity 31 Entity 31 polymer

Description description	complex I
Molecular weight formula_weight	46056.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXXXXXXXXXCXXCXXXXXXXXXXXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHXXXCXXCXXXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXCXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 32 Entity 32 polymer

Description description	complex I
Molecular weight formula_weight	26655.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

Entity 33 Entity 33 polymer

Description description	complex I
Molecular weight formula_weight	13949.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXCXXCXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXCXXCXXCXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 34 Entity 34 polymer

Description description	complex I
Molecular weight formula_weight	14570.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 35 Entity 35 polymer

Description description	complex I
Molecular weight formula_weight	7166.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 36 Entity 36 polymer

Description description	complex I
Molecular weight formula_weight	51166.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 37 Entity 37 polymer

Description description	complex I
Molecular weight formula_weight	38570.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

Entity 38 Entity 38 polymer

Description description	complex I
Molecular weight formula_weight	29379.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

Entity 39 Entity 39 polymer

Description description	complex I
Molecular weight formula_weight	18741.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

Entity 40 Entity 40 polymer

Description description	complex I
Molecular weight formula_weight	25804.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

Entity 41 Entity 41 polymer

Description description	complex I
Molecular weight formula_weight	7251.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 42 Entity 42 polymer

Description description	complex I
Molecular weight formula_weight	4017.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 43 Entity 43 polymer

Description description	complex I
Molecular weight formula_weight	6826.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 44 Entity 44 polymer

Description description	complex I
Molecular weight formula_weight	6400.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 45 Entity 45 polymer

Description description	complex I
Molecular weight formula_weight	6060.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 46 Entity 46 polymer

Description description	complex I
Molecular weight formula_weight	6145.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 47 Entity 47 polymer

Description description	complex I
Molecular weight formula_weight	28102.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

Entity 48 Entity 48 polymer

Description description	complex I
Molecular weight formula_weight	9039.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 49 Entity 49 polymer

Description description	complex I
Molecular weight formula_weight	12102.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 50 Entity 50 polymer

Description description	complex I
Molecular weight formula_weight	70484.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

Entity 51 Entity 51 polymer

Description description	complex I
Molecular weight formula_weight	53208.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

Entity 52 Entity 52 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 53 Entity 53 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 54 Entity 54 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 55 Entity 55 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 56 Entity 56 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 57 Entity 57 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 58 Entity 58 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 59 Entity 59 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	17093

Cryo-EM of bovine respirasome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer