6mzd

Human TFIID Lobe A canonical

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF1_HUMAN
Isoform	P21675-2
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1873； UniProt 21–1893

Transcription initiation factor TFIID subunit 3

OrganismNot specified

UniProt Q5VWG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF3_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–929； UniProt 1–929

Transcription initiation factor TFIID subunit 4

OrganismNot specified

UniProt O00268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF4_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–1085； UniProt 1–1085

Transcription initiation factor TFIID subunit 5

OrganismNot specified

UniProt Q15542

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–496； UniProt 1–496 Author chain F； PDBConstruct 537–800； UniProt 537–800

Transcription initiation factor TFIID subunit 6

OrganismNot specified

UniProt P49848

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF6_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain H； PDBConstruct 1–677； UniProt 1–677

Transcription initiation factor TFIID subunit 9

OrganismNot specified

UniProt Q16594

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF9_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–109； UniProt 1–109 Author chain L； PDBConstruct 117–264； UniProt 117–264

Transcription initiation factor TFIID subunit 10

OrganismNot specified

UniProt Q12962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF10_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–218； UniProt 1–218

Transcription initiation factor TFIID subunit 11

OrganismNot specified

UniProt Q15544

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF11_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain P； PDBConstruct 1–211； UniProt 1–211

Transcription initiation factor TFIID subunit 12

OrganismNot specified

UniProt Q16514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF12_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Q； PDBConstruct 1–161； UniProt 1–161

Transcription initiation factor TFIID subunit 13

OrganismNot specified

UniProt Q15543

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF13_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain S； PDBConstruct 1–124； UniProt 1–124

TATA-box-binding protein

OrganismNot specified

UniProt P20226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 4 × 1 （O00268） Transcription initiation factor TFIID subunit 5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） poly(UNK) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain T； PDBConstruct 1–339； UniProt 1–339

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6mzd
Deposition date deposition_date	2018-11-05
Structure title title	Human TFIID Lobe A canonical
Keywords keywords	Transcription, DNA, Nuclear; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6mzd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6mzd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6mzd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.03 Å
Rg (electron density)	42.35 Å
Total Rg	42.48 Å
Atom count	11120
Residues	1481
Excluded volume	196430 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6mzd__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Transcription initiation factor TFIID subunit 1
Molecular weight formula_weight	213050.1 kDa
EC 编号 ec_number	2.3.1.48,2.7.11.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	11120

MSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGVSENGEGIILPSIIAPSSLASEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Entity 2 Entity 2 polymer

Description description	Transcription initiation factor TFIID subunit 3
Molecular weight formula_weight	103769.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLAPPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKKRKHRAH

Entity 3 Entity 3 polymer

Description description	Transcription initiation factor TFIID subunit 4
Molecular weight formula_weight	110221.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK

Entity 4 Entity 4 polymer

Description description	Transcription initiation factor TFIID subunit 5
Molecular weight formula_weight	85785.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

Entity 5 Entity 5 polymer

Description description	Transcription initiation factor TFIID subunit 6
Molecular weight formula_weight	72749.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP

Entity 6 Entity 6 polymer

Description description	Transcription initiation factor TFIID subunit 9
Molecular weight formula_weight	28830.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPXXXXXXXPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL

Entity 7 Entity 7 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21731.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Entity 8 Entity 8 polymer

Description description	Transcription initiation factor TFIID subunit 11
Molecular weight formula_weight	23340.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF

Entity 9 Entity 9 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	17948.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Entity 10 Entity 10 polymer

Description description	Transcription initiation factor TFIID subunit 13
Molecular weight formula_weight	14307.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

Entity 11 Entity 11 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	37729.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Entity 12 Entity 12 polymer

Description description	poly(UNK)
Molecular weight formula_weight	8188.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	107900

Human TFIID Lobe A canonical

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer