6ugm

Structural basis of COMPASS eCM recognition of an unmodified nucleosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q92133_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–135； UniProt 2–136 Author chain E； PDBConstruct 1–135； UniProt 2–136

Histone H4

Xenopus laevis

UniProt P62799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–102； UniProt 2–103 Author chain F； PDBConstruct 1–102； UniProt 2–103

Histone H2A

Xenopus laevis

UniProt Q6AZJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6AZJ8_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–107； UniProt 13–119 Author chain G； PDBConstruct 1–107； UniProt 13–119

Histone H2B

Xenopus laevis

UniProt A0A1L8FQ56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1L8FQ56_XENLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–125； UniProt 2–126

Histone H2B 1.1

Xenopus laevis

UniProt P02281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B11_XENLA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain H； PDBConstruct 1–125； UniProt 2–126

Swd3

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

UniProt Q6CLY5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6CLY5_KLULA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–327； UniProt 1–327

Histone-lysine N-methyltransferase, H3 lysine-4 specific

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

UniProt Q6CIT4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SET1_KLULA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–275； UniProt 726–1000

Swd1

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

UniProt Q6CXF3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6CXF3_KLULA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–439； UniProt 1–439

Spp1

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

UniProt Q6CRQ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Bre2 × 1 （Q6CTQ1） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6CRQ4_KLULA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain X； PDBConstruct 1–342； UniProt 1–342

Bre2

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

UniProt Q6CTQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Sdc1 × 2 （Q6CPN6） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6CTQ1_KLULA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–405； UniProt 1–405

Sdc1

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

UniProt Q6CPN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （Q92133） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B × 1 （A0A1L8FQ56） Histone H2B 1.1 × 1 （P02281） DNA (146-MER) × 1 DNA (146-MER) × 1 Swd3 × 1 （Q6CLY5） Histone-lysine N-methyltransferase, H3 lysine-4 specific × 1 （Q6CIT4） Swd1 × 1 （Q6CXF3） H3 N-terminus × 1 Spp1 × 1 （Q6CRQ4） Bre2 × 1 （Q6CTQ1） S-ADENOSYLMETHIONINE × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6CPN6_KLULA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–134； UniProt 1–134 Author chain P； PDBConstruct 1–134； UniProt 1–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ugm
Deposition date deposition_date	2019-09-26
Structure title title	Structural basis of COMPASS eCM recognition of an unmodified nucleosome
Keywords keywords	Complex, methyltransferase, epigenetics, chromatin, nucleosome, TRANSFERASE-STRUCTURAL PROTEIN-DNA complex; TRANSFERASE/STRUCTURAL PROTEIN/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ugm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ugm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ugm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	50.73 Å
Rg (electron density)	50.17 Å
Total Rg	50.44 Å
Atom count	23609
Residues	2497
Excluded volume	401580 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ugm__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Histone H3
Molecular weight formula_weight	15275.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	23609

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Histone H4
Molecular weight formula_weight	11263.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Histone H2A
Molecular weight formula_weight	11694.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Histone H2B
Molecular weight formula_weight	13848.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Histone H2B 1.1
Molecular weight formula_weight	13834.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	DNA (146-MER)
Molecular weight formula_weight	45114.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	I

CTCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCGAT

Entity 7 Entity 7 polymer

Description description	DNA (146-MER)
Molecular weight formula_weight	45305.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	J

ATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCGA

Entity 8 Entity 8 polymer

Description description	Swd3
Molecular weight formula_weight	36458.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MCDLDSVSDLTLTLRMLQFDKQVLPASGKISTSCQISPDGELIAICQNTDMLVYEISSSKMMKLTTTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGRIRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYNCGLELIYPQGKDPLVISGNDSGSMCVWNVYSKNLVQKIDEKHRNSPLISISASYDKVATLSLNGECNLFRVH

Source Source

Source organism organism	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	284590
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Histone-lysine N-methyltransferase, H3 lysine-4 specific
Molecular weight formula_weight	31448.5 kDa
EC 编号 ec_number	2.1.1.43
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

YQQIEQNGIIRDNQIALNEKEFDSTLASTTGSFIAEGFKKIPDKLKSSYLLHHRRLAQPLNTVHNHQEQNFMALNGTESTNQEADLEQDNHNASSRLNRVFQRRFQQDIEAQRAAIGFESDLLSLNQLTKRKKPVTFARSAIHNWGLYALEPIAAKEMIIEYVGESIRQPVAEMREKRYIKSGIGSSYLFRIDENTVIDATKRGGIARFINHCCEPSCTAKIIKVDGRKRIVIYALRDIGTNEELTYDYKFERETDEGERLPCLCGAPSCKGFLN

Source Source

Source organism organism	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	284590
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Swd1
Molecular weight formula_weight	49894.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MANLLLQDPFGVLKEYPEKLTHTLEVPVAAVCVKFSPRGDYLAVGCSNGAIIIYDMDSLKPIAMLGTHSGAHTRSVQSVCWSNDGRYLWSSGRDWYAKLWDMTQPTKCFQQYKFDGPLWSCHVVRWNVCIVTVVEEPTAYVLTLTDRQNAFHCFPLLEQDQDISGHGYTLVACPHPTIESIIITGTSKGWINAFQLDLESGFEDKIRCCYEEKIANANIKQIIISPSGTRIAINGSDRTIRQYQLIVEDNESEGGSSHSVSIELEHKYQDIINRLQWNTIFFSNHSGEYLVASAHGSSAHDLYLWETSSGSLVRVLEGADEELLDIDWNFYSMRIASNGFESGWVYMWSIVIPPKWSALAPDFEEVEENIDYQEKENEFDIMDDDNNLQAMTEAEEIAIDLCTPEKYDVRGNDISMPSFVIPIDYEGVIIQQHWAHQEQ

Source Source

Source organism organism	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	284590
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	H3 N-terminus
Molecular weight formula_weight	378.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

TMQ

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	Spp1
Molecular weight formula_weight	39297.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSLPSWCPRYDSRKHDPKTGEEVYCICKKPDTGELMVGCDGCDDWFHFSCLKIPEKYRDLVFSFYCSYCSAGITGPALINGGKLPKTLWKRKCRLPECYTECDANSRSKYCSKKHAVQYVQSIVDKLNLPGVDKIALLRQLLNETTSLEEFKTLGRDKLPEVTSPLSKDQYSKLLENDQHLNKLINEHDELVSVKLSKLNEEDAVIEKYVNWIGEVNERLSPHFNQPTGRKKSKSASKVTICGYHNEFTIPRSVEEFLDKLLQLKEDENSNITSVDGVCVKTKCAKHQDWITLSQNDLSEQKDSLENVKRRLDLLISVRTNQLRISFFEQEMSNRVLPGVKT

Source Source

Source organism organism	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	284590
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Bre2
Molecular weight formula_weight	47287.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSVPVIPYLDYDIVDLGSDIKKPDFPQLSESHRINEQQYYITEDTPLNKRNFMYQPCAANLMLDKLKYCGTDYFDKSSINLMDRSDKLAFSLDDHSVSVSENCGWRSVRSDVCMKEGKIYWEVEVKNVSDTSHIRCGISRREASTETPVGCDFYGYSIRDKGLQVIHEGRLHTVLKPHEMQAGDRIGFLLTLPSLQSQSEQAMDYSLKRIQELNNDDSRTNKRNKKFNKEFYKFLLRSCEPTNVVRDQIAIRYKNQLFYESTDYVKTTKPEYYDNRDDMQKFYELENSSFEVFVNGVSHGIAFEGLTPFLPPFSELQYNEKFYLHHWNKRNVTKGIEIRNKYVNNNRLGYYATLSSFQGGTASIITEAMELKFLPKDVDIKTLNDIYNEQIASDIVWDLIDEIDT

Source Source

Source organism organism	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	284590
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 polymer

Description description	Sdc1
Molecular weight formula_weight	14722.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P

MSEPVMENMAPEDVVKLEKEEHIVPDIGVSSISTTEPLSPSGIPRESSGTVTSATAATTEREVSPKKELQIDHDRVDPVAMIGGSTTRRYLNEHVTKHLLEGMKLIAREKPEDPLRVLGQFLIDASEMNQKPSS

Source Source

Source organism organism	Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	284590
Host organism host_organism	Trichoplusia ni

Entity 15 Entity 15 non-polymer

Description description	S-ADENOSYLMETHIONINE
Molecular weight formula_weight	398.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6ugmA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ugmB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ugmC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ugmD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ugmE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ugmF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ugmG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ugmH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	100905

Structural basis of COMPASS eCM recognition of an unmodified nucleosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B 1.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Swd3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone-lysine N-methyltransferase, H3 lysine-4 specific

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Swd1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spp1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Bre2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer