8dh6

Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–534； UniProt 1–534

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain b； PDBConstruct 1–236； UniProt 16–251

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain c； PDBConstruct 1–269； UniProt 1–269

Cytochrome c oxidase subunit 4, mitochondrial

OrganismNot specified

UniProt P04037

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–130； UniProt 26–155

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00424

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain e； PDBConstruct 1–133； UniProt 21–153

Cytochrome c oxidase subunit 6, mitochondrial

OrganismNot specified

UniProt P00427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–108； UniProt 41–148

Cytochrome c oxidase subunit 7, mitochondrial

OrganismNot specified

UniProt P10174

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain g； PDBConstruct 1–59； UniProt 2–60

Cytochrome c oxidase subunit 8, mitochondrial

OrganismNot specified

UniProt P04039

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain h； PDBConstruct 1–51； UniProt 28–78

Cytochrome c oxidase subunit 9, mitochondrial

OrganismNot specified

UniProt P07255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） CALCIUM ION × 1 MAGNESIUM ION × 1 COPPER (II) ION × 2 HEME-A × 2 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain i； PDBConstruct 1–55； UniProt 2–56

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8dh6
Deposition date deposition_date	2022-06-25
Structure title title	Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs
Keywords keywords	cytochrome c oxidase, Complex IV, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8dh6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8dh6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8dh6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.63 Å
Rg (electron density)	36.36 Å
Total Rg	36.89 Å
Atom count	12901
Residues	1560
Excluded volume	235590 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8dh6__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	58832.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a
Atom count atom_count	12901

MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

Entity 2 Entity 2 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26779.8 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

DVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

Entity 3 Entity 3 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	30383.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV

Entity 4 Entity 4 polymer

Description description	Cytochrome c oxidase subunit 4, mitochondrial
Molecular weight formula_weight	14188.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

QQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH

Entity 5 Entity 5 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	14891.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

AQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK

Entity 6 Entity 6 polymer

Description description	Cytochrome c oxidase subunit 6, mitochondrial
Molecular weight formula_weight	12642.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

SDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit 7, mitochondrial
Molecular weight formula_weight	6811.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

ANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA

Entity 8 Entity 8 polymer

Description description	Cytochrome c oxidase subunit 8, mitochondrial
Molecular weight formula_weight	5737.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

VHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF

Entity 9 Entity 9 polymer

Description description	Cytochrome c oxidase subunit 9, mitochondrial
Molecular weight formula_weight	6471.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

TIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKK

Entity 10 Entity 10 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 15 Entity 15 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	8dh6a01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	8dh6b01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	8dh6b02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.94 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	247631

Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5A, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8dh6__assembly_1__model_1

8dh6__assembly_1__model_1 | I(q)

8dh6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment