6giq

Saccharomyces cerevisiae respiratory supercomplex III2IV

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BJ4_G0001550.mRNA.1.CDS.1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q3X1_YEASX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–457； UniProt 1–457 Author chain L； PDBConstruct 1–457； UniProt 1–457

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt A0A6A5Q625

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q625_YEASX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–368； UniProt 1–368 Author chain M； PDBConstruct 1–368； UniProt 1–368

Cytochrome b

OrganismNot specified

UniProt A0A0G3F5W7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G3F5W7_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–385； UniProt 1–385 Author chain N； PDBConstruct 1–385； UniProt 1–385

BJ4_G0049990.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A5B9RH60

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5B9RH60_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–309； UniProt 1–309 Author chain O； PDBConstruct 1–309； UniProt 1–309

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt A0A6A5PX11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PX11_YEASX
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215 Author chain P； PDBConstruct 1–215； UniProt 1–215

QCR6 isoform 1

OrganismNot specified

UniProt A0A6A5Q022

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q022_YEASX
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–147； UniProt 1–147 Author chain Q； PDBConstruct 1–147； UniProt 1–147

Complex III subunit 7

OrganismNot specified

UniProt A0A6A5Q2H4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q2H4_YEASX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–127； UniProt 1–127 Author chain R； PDBConstruct 1–127； UniProt 1–127

BJ4_G0028260.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PU80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PU80_YEASX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–94； UniProt 1–94 Author chain S； PDBConstruct 1–94； UniProt 1–94

HLJ1_G0021680.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6L0Z0I8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L0Z0I8_YEASX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–66； UniProt 1–66 Author chain T； PDBConstruct 1–66； UniProt 1–66

BJ4_G0023510.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6L0ZE60

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L0ZE60_YEASX
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–77； UniProt 1–77 Author chain V； PDBConstruct 1–77； UniProt 1–77

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt P00401

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain a； PDBConstruct 1–534； UniProt 1–534

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt A0A0H3WI21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H3WI21_YEASX
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain b； PDBConstruct 1–251； UniProt 1–251

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt A0A0G3F1J2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G3F1J2_YEASX
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain c； PDBConstruct 1–269； UniProt 1–269

BJ4_G0018620.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PV33

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PV33_YEASX
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain d； PDBConstruct 1–155； UniProt 1–155

BJ4_G0046460.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5Q8F6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q8F6_YEASX
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain e； PDBConstruct 1–153； UniProt 1–153

BJ4_G0024040.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PUE0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PUE0_YEASX
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain f； PDBConstruct 1–148； UniProt 1–148

BJ4_G0043230.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PQU1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PQU1_YEASX
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain g； PDBConstruct 1–60； UniProt 1–60

BJ4_G0038800.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PRD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PRD8_YEASX
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain h； PDBConstruct 1–78； UniProt 1–78

Cytochrome c oxidase polypeptide VIIA

OrganismNot specified

UniProt A0A6A5Q104

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q104_YEASX
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain i； PDBConstruct 1–59； UniProt 1–59

BJ4_G0035470.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A6A5PU81

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） Cytochrome c oxidase subunit × 1 （A0A6A5PWA0） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PU81_YEASX
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain j； PDBConstruct 1–83； UniProt 1–83

Cytochrome c oxidase subunit

OrganismNot specified

UniProt A0A6A5PWA0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	BJ4_G0001550.mRNA.1.CDS.1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b × 2 （A0A0G3F5W7） BJ4_G0049990.mRNA.1.CDS.1 × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A6A5PX11） QCR6 isoform 1 × 2 （A0A6A5Q022） Complex III subunit 7 × 2 （A0A6A5Q2H4） BJ4_G0028260.mRNA.1.CDS.1 × 2 （A0A6A5PU80） HLJ1_G0021680.mRNA.1.CDS.1 × 2 （A0A6L0Z0I8） BJ4_G0023510.mRNA.1.CDS.1 × 2 （A0A6L0ZE60） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （A0A0H3WI21） Cytochrome c oxidase subunit 3 × 1 （A0A0G3F1J2） BJ4_G0018620.mRNA.1.CDS.1 × 1 （A0A6A5PV33） BJ4_G0046460.mRNA.1.CDS.1 × 1 （A0A6A5Q8F6） BJ4_G0024040.mRNA.1.CDS.1 × 1 （A0A6A5PUE0） BJ4_G0043230.mRNA.1.CDS.1 × 1 （A0A6A5PQU1） BJ4_G0038800.mRNA.1.CDS.1 × 1 （A0A6A5PRD8） Cytochrome c oxidase polypeptide VIIA × 1 （A0A6A5Q104） BJ4_G0035470.mRNA.1.CDS.1 × 1 （A0A6A5PU81） Unknown Cox subunit × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEME C × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 1 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PWA0_YEASX
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain k； PDBConstruct 1–129； UniProt 1–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6giq
Deposition date deposition_date	2018-05-15
Structure title title	Saccharomyces cerevisiae respiratory supercomplex III2IV
Keywords keywords	Respiratory chain, supercomplex, bc1 complex, cytochrome c oxidase, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6giq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6giq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6giq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	63.34 Å
Rg (electron density)	62.63 Å
Total Rg	62.65 Å
Atom count	44120
Residues	5470
Excluded volume	795310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6giq__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (35)

Entity 1 Entity 1 polymer

Description description	BJ4_G0001550.mRNA.1.CDS.1
Molecular weight formula_weight	50282.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	44120

MLRTVTSKTVSNQFKRSLATAVATPKAEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	40528.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

MLSAARLQFAQGSVRRLTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43686.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

Entity 4 Entity 4 polymer

Description description	BJ4_G0049990.mRNA.1.CDS.1
Molecular weight formula_weight	34097.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITASTLLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	23394.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

MLGIRSSVKTCFKPMSLTSKRLISQSLLASKSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

Entity 6 Entity 6 polymer

Description description	QCR6 isoform 1
Molecular weight formula_weight	17276.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDDDDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 7 Entity 7 polymer

Description description	Complex III subunit 7
Molecular weight formula_weight	14583.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

Entity 8 Entity 8 polymer

Description description	BJ4_G0028260.mRNA.1.CDS.1
Molecular weight formula_weight	10987.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV

Entity 9 Entity 9 polymer

Description description	HLJ1_G0021680.mRNA.1.CDS.1
Molecular weight formula_weight	7485.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T

MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDGDDDDE

Entity 10 Entity 10 polymer

Description description	BJ4_G0023510.mRNA.1.CDS.1
Molecular weight formula_weight	8602.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V

MAYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPLLGPTLEDHTPPEDKPN

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	58832.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	28585.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MLDLLRLQLTTFIMNDVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	30383.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV

Entity 14 Entity 14 polymer

Description description	BJ4_G0018620.mRNA.1.CDS.1
Molecular weight formula_weight	17164.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH

Entity 15 Entity 15 polymer

Description description	BJ4_G0046460.mRNA.1.CDS.1
Molecular weight formula_weight	17161.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK

Entity 16 Entity 16 polymer

Description description	BJ4_G0024040.mRNA.1.CDS.1
Molecular weight formula_weight	17366.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS

Entity 17 Entity 17 polymer

Description description	BJ4_G0043230.mRNA.1.CDS.1
Molecular weight formula_weight	6942.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA

Entity 18 Entity 18 polymer

Description description	BJ4_G0038800.mRNA.1.CDS.1
Molecular weight formula_weight	8921.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF

Entity 19 Entity 19 polymer

Description description	Cytochrome c oxidase polypeptide VIIA
Molecular weight formula_weight	6974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKKQEN

Entity 20 Entity 20 polymer

Description description	BJ4_G0035470.mRNA.1.CDS.1
Molecular weight formula_weight	9799.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD

Entity 21 Entity 21 polymer

Description description	Cytochrome c oxidase subunit
Molecular weight formula_weight	15046.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MFRQCAKRYASSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDD

Entity 22 Entity 22 polymer

Description description	Unknown Cox subunit
Molecular weight formula_weight	2656.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 23 Entity 23 non-polymer

Description description	(1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate
Molecular weight formula_weight	592.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 24 Entity 24 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 25 Entity 25 non-polymer

Description description	(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 26 Entity 26 non-polymer

Description description	(5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate
Molecular weight formula_weight	634.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	(1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate
Molecular weight formula_weight	564.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	(1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate
Molecular weight formula_weight	593.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 32 Entity 32 non-polymer

Description description	;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ;
Molecular weight formula_weight	834.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 34 Entity 34 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 35 Entity 35 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 32 domains

CATH v4.4 (32 domains)

Domain ID domain_id	6giqA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	6giqD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	6giqD02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	6giqE01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	6giqE02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6giqF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	6giqG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	6giqH00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	6giqI00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	6giqL01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqL02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqM01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqM02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6giqN00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	6giqO01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	6giqO02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	6giqP01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	6giqP02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6giqQ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	6giqR00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	6giqS00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	6giqT00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	6giqa00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6giqb01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	6giqb02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	6giqc01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6giqc02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6giqf00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	40 — Cytochrome c oxidase, subunit Va/VI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.23 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	203271

Saccharomyces cerevisiae respiratory supercomplex III2IV

1. Protein Identity and Related Structures Protein Identity & Related Structures

BJ4_G0001550.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BJ4_G0049990.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

QCR6 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Complex III subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BJ4_G0028260.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HLJ1_G0021680.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BJ4_G0023510.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer