8yio

Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COR1 isoform 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q3X1_YEASX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–431； UniProt 27–457 Author chain L； PDBConstruct 1–431； UniProt 27–457

Cytochrome b

OrganismNot specified

UniProt A0A0G3F5W7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G3F5W7_YEASX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–385； UniProt 1–385 Author chain N； PDBConstruct 1–385； UniProt 1–385

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt A0A6A5Q625

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q625_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–352； UniProt 17–368 Author chain M； PDBConstruct 1–352； UniProt 17–368

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt A0A5B9RH60

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5B9RH60_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–248； UniProt 62–309 Author chain O； PDBConstruct 1–248； UniProt 62–309

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt A0A8H8ULJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8H8ULJ0_YEASX
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–185； UniProt 31–215 Author chain P； PDBConstruct 1–185； UniProt 31–215

QCR6 isoform 1

OrganismNot specified

UniProt A0A8H8ULB7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8H8ULB7_YEASX
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–75； UniProt 73–147 Author chain Q； PDBConstruct 1–75； UniProt 73–147

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt A0A6A5Q2H4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q2H4_YEASX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–126； UniProt 2–127 Author chain R； PDBConstruct 1–126； UniProt 2–127

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt A0A6A5PU80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PU80_YEASX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–93； UniProt 2–94 Author chain S； PDBConstruct 1–93； UniProt 2–94

Cytochrome b-c1 complex subunit 9, mitochondrial

OrganismNot specified

UniProt P22289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–55； UniProt 4–58 Author chain T； PDBConstruct 1–55； UniProt 4–58

Cytochrome b-c1 complex subunit 10, mitochondrial

OrganismNot specified

UniProt P37299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	COR1 isoform 1 × 2 （A0A6A5Q3X1） Cytochrome b × 2 （A0A0G3F5W7） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （A0A6A5Q625） Cytochrome c1, heme protein, mitochondrial × 2 （A0A5B9RH60） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （A0A8H8ULJ0） QCR6 isoform 1 × 2 （A0A8H8ULB7） Cytochrome b-c1 complex subunit 7 × 2 （A0A6A5Q2H4） Cytochrome b-c1 complex subunit 8 × 2 （A0A6A5PU80） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–52； UniProt 10–61 Author chain V； PDBConstruct 1–52； UniProt 10–61

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8yio
Deposition date deposition_date	2024-02-29
Structure title title	Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state
Keywords keywords	Complex, mitochondria, ELECTRON TRANSPORT, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8yio__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8yio__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8yio__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.56 Å
Rg (electron density)	54.48 Å
Total Rg	54.60 Å
Atom count	32370
Residues	3992
Excluded volume	581910 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8yio__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	COR1 isoform 1
Molecular weight formula_weight	47459.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	32370

AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW

Entity 2 Entity 2 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43686.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

Entity 3 Entity 3 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	38751.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27807.4 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	20123.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

Entity 6 Entity 6 polymer

Description description	QCR6 isoform 1
Molecular weight formula_weight	8983.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

EVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	14452.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

PQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	10856.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 9, mitochondrial
Molecular weight formula_weight	6301.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T

SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 10, mitochondrial
Molecular weight formula_weight	5880.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V

KTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPL

Entity 11 Entity 11 non-polymer

Description description	METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE
Molecular weight formula_weight	403.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 non-polymer

Description description	(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	(1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate
Molecular weight formula_weight	593.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 16 Entity 16 non-polymer

Description description	(5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate
Molecular weight formula_weight	634.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ;
Molecular weight formula_weight	834.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	(1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate
Molecular weight formula_weight	592.8 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.35 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	433970

Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state

1. Protein Identity and Related Structures Protein Identity & Related Structures

COR1 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

QCR6 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer