6hu9

III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–431； UniProt 27–457 Author chain L； PDBConstruct 1–431； UniProt 27–457

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P07257

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–352； UniProt 17–368 Author chain M； PDBConstruct 1–352； UniProt 17–368

Cytochrome b

OrganismNot specified

UniProt P00163

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–385； UniProt 1–385 Author chain N； PDBConstruct 1–385； UniProt 1–385

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P07143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–248； UniProt 62–309 Author chain O； PDBConstruct 1–248； UniProt 62–309

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P08067

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–185； UniProt 31–215 Author chain P； PDBConstruct 1–185； UniProt 31–215

Cytochrome b-c1 complex subunit 6

OrganismNot specified

UniProt P00127

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–147； UniProt 1–147 Author chain Q； PDBConstruct 1–147； UniProt 1–147

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt P00128

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–127； UniProt 1–127 Author chain R； PDBConstruct 1–127； UniProt 1–127

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt P08525

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–93； UniProt 2–94 Author chain S； PDBConstruct 1–93； UniProt 2–94

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt P22289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–66； UniProt 1–66 Author chain T； PDBConstruct 1–66； UniProt 1–66

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt P37299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–77； UniProt 1–77 Author chain U； PDBConstruct 1–77； UniProt 1–77

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt P00401

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain a； PDBConstruct 1–534； UniProt 1–534 Author chain m； PDBConstruct 1–534； UniProt 1–534

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain b； PDBConstruct 1–236； UniProt 16–251 Author chain n； PDBConstruct 1–236； UniProt 16–251

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain c； PDBConstruct 1–269； UniProt 1–269 Author chain o； PDBConstruct 1–269； UniProt 1–269

Cytochrome c oxidase subunit 4, mitochondrial

OrganismNot specified

UniProt P04037

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX4_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain d； PDBConstruct 1–130； UniProt 26–155 Author chain p； PDBConstruct 1–130； UniProt 26–155

Cytochrome c oxidase polypeptide 5A, mitochondrial

OrganismNot specified

UniProt P00424

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain e； PDBConstruct 1–133； UniProt 21–153 Author chain q； PDBConstruct 1–133； UniProt 21–153

Cytochrome c oxidase subunit 6, mitochondrial

OrganismNot specified

UniProt P00427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain f； PDBConstruct 1–108； UniProt 41–148 Author chain r； PDBConstruct 1–108； UniProt 41–148

Cytochrome c oxidase subunit 7

OrganismNot specified

UniProt P10174

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain g； PDBConstruct 1–59； UniProt 2–60 Author chain s； PDBConstruct 1–59； UniProt 2–60

Cytochrome c oxidase polypeptide VIII, mitochondrial

OrganismNot specified

UniProt P04039

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain h； PDBConstruct 1–47； UniProt 28–74 Author chain t； PDBConstruct 1–47； UniProt 28–74

Cytochrome c oxidase subunit 7A

OrganismNot specified

UniProt P07255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX9_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain i； PDBConstruct 1–55； UniProt 2–56 Author chain u； PDBConstruct 1–55； UniProt 2–56

Cytochrome c oxidase subunit 6B

OrganismNot specified

UniProt Q01519

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX12_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain j； PDBConstruct 1–82； UniProt 2–83 Author chain v； PDBConstruct 1–82； UniProt 2–83

Cytochrome c oxidase subunit 6A, mitochondrial

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cox26 × 2 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX13_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain k； PDBConstruct 1–120； UniProt 10–129 Author chain w； PDBConstruct 1–120； UniProt 10–129

Cox26

OrganismNot specified

UniProt Q2V2P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6 × 2 （P00127） Cytochrome b-c1 complex subunit 7 × 2 （P00128） Cytochrome b-c1 complex subunit 8 × 2 （P08525） Cytochrome b-c1 complex subunit 9 × 2 （P22289） Cytochrome b-c1 complex subunit 10 × 2 （P37299） Cytochrome c oxidase subunit 1 × 2 （P00401） Cytochrome c oxidase subunit 2 × 2 （P00410） Cytochrome c oxidase subunit 3 × 2 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 2 （P04037） Cytochrome c oxidase polypeptide 5A, mitochondrial × 2 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 2 （P00427） Cytochrome c oxidase subunit 7 × 2 （P10174） Cytochrome c oxidase polypeptide VIII, mitochondrial × 2 （P04039） Cytochrome c oxidase subunit 7A × 2 （P07255） Cytochrome c oxidase subunit 6B × 2 （Q01519） Cytochrome c oxidase subunit 6A, mitochondrial × 2 （P32799） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 PROTOPORPHYRIN IX CONTAINING FE × 4 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CARDIOLIPIN × 8 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 2 HEME-A × 4 CALCIUM ION × 2 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YD19A_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain l； PDBConstruct 1–66； UniProt 1–66 Author chain x； PDBConstruct 1–66； UniProt 1–66

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6hu9
Deposition date deposition_date	2018-10-05
Structure title title	III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae
Keywords keywords	;Cytochrome c oxidase Cytochrome bc1 Mitochondria Respiratory chain Supercomplex, OXIDOREDUCTASE, ELECTRON TRANSPORT, OXIDOREDUCTASE-ELECTRON TRANSPORT complex ;; OXIDOREDUCTASE/ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6hu9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6hu9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6hu9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	75.58 Å
Rg (electron density)	75.74 Å
Total Rg	75.57 Å
Atom count	62988
Residues	7636
Excluded volume	1139800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6hu9__assembly_1__model_1`	44-meric （44）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (35)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	47459.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	63031

AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	38751.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43686.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27807.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	20123.0 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 6
Molecular weight formula_weight	17276.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDDDDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	14583.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	10856.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7485.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T

MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDGDDDDE

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	8602.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,U

MAYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPLLGPTLEDHTPPEDKPN

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	58832.6 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,m

MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26779.8 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,n

DVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	30383.6 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,o

MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV

Entity 14 Entity 14 polymer

Description description	Cytochrome c oxidase subunit 4, mitochondrial
Molecular weight formula_weight	14188.9 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,p

QQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH

Entity 15 Entity 15 polymer

Description description	Cytochrome c oxidase polypeptide 5A, mitochondrial
Molecular weight formula_weight	14891.8 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,q

AQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK

Entity 16 Entity 16 polymer

Description description	Cytochrome c oxidase subunit 6, mitochondrial
Molecular weight formula_weight	12642.0 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,r

SDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS

Entity 17 Entity 17 polymer

Description description	Cytochrome c oxidase subunit 7
Molecular weight formula_weight	6811.2 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,s

ANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA

Entity 18 Entity 18 polymer

Description description	Cytochrome c oxidase polypeptide VIII, mitochondrial
Molecular weight formula_weight	5375.4 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,t

VHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKK

Entity 19 Entity 19 polymer

Description description	Cytochrome c oxidase subunit 7A
Molecular weight formula_weight	6471.7 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,u

TIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKK

Entity 20 Entity 20 polymer

Description description	Cytochrome c oxidase subunit 6B
Molecular weight formula_weight	9668.7 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,v

ADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD

Entity 21 Entity 21 polymer

Description description	Cytochrome c oxidase subunit 6A, mitochondrial
Molecular weight formula_weight	15117.0 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,w

ASSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDDGARGSHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 22 Entity 22 polymer

Description description	Cox26
Molecular weight formula_weight	7461.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,x

MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKARKA

Entity 23 Entity 23 non-polymer

Description description	DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 24 Entity 24 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 25 Entity 25 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 26 Entity 26 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 27 Entity 27 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 28 Entity 28 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 32 Entity 32 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 35 Entity 35 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 42 domains

CATH v4.4 (42 domains)

Domain ID domain_id	6hu9A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9B01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9B02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	6hu9D01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	6hu9D02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	6hu9E01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	6hu9E02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6hu9F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	6hu9G00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	6hu9H00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	6hu9I00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	6hu9L01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9L02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9M01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9M02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	6hu9N00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	6hu9O01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	6hu9O02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	6hu9P01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	6hu9P02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6hu9Q00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	6hu9R00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	6hu9S00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	6hu9T00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	6hu9a00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6hu9b01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	6hu9b02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	6hu9c01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6hu9c02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6hu9f00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	40 — Cytochrome c oxidase, subunit Va/VI

Domain ID domain_id	6hu9h00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	49 — Cytochrome C Oxidase; Chain L
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit VIIc

Domain ID domain_id	6hu9j00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	140 — Cytochrome c oxidase, subunit VIb

Domain ID domain_id	6hu9m00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6hu9n01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	6hu9n02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	6hu9o01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6hu9o02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6hu9r00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	40 — Cytochrome c oxidase, subunit Va/VI

Domain ID domain_id	6hu9t00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	49 — Cytochrome C Oxidase; Chain L
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit VIIc

Domain ID domain_id	6hu9v00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	140 — Cytochrome c oxidase, subunit VIb

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.35 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	44915

III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer