SAXSdb — 9gs2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial chaperone BCS1

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 1–456 Chain B； UniProt 1–456 Chain C； UniProt 1–456 Chain D； UniProt 1–456 Chain E； UniProt 1–456 Chain F； UniProt 1–456 Chain G； UniProt 1–456	Not recorded	Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （P08067） FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.46 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9GS2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6SH3 Structure of the ADP state of the heptameric Bcs1 AAA-ATPase Deposited 2019-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–456（456 aa） Chain B 1–456（456 aa） Chain C 1–456（456 aa） Chain D 1–456（456 aa） Chain E 1–456（456 aa） Chain F 1–456（456 aa） Chain G 1–456（456 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6SH4 Structure of the Apo1 state of the heptameric Bcs1 AAA-ATPase. Deposited 2019-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–456（456 aa） Chain B 1–456（456 aa） Chain C 1–456（456 aa） Chain D 1–456（456 aa） Chain E 1–456（456 aa） Chain F 1–456（456 aa） Chain G 1–456（456 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
6SH5 Structure of the Apo2 state of the heptameric Bcs1 AAA-ATPase Deposited 2019-08-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–456（456 aa） Chain B 1–456（456 aa） Chain C 1–456（456 aa） Chain D 1–456（456 aa） Chain E 1–456（456 aa） Chain F 1–456（456 aa） Chain G 1–456（456 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
9GSN Structure of the ATPgS-S1 state of the heptameric Bcs1 AAA-ATPase Deposited 2024-09-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–456（456 aa） Chain B 1–456（456 aa） Chain C 1–456（456 aa） Chain D 1–456（456 aa） Chain E 1–456（456 aa） Chain F 1–456（456 aa） Chain G 1–456（456 aa）	Not recorded	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å
9GU9 Structure of the ATPgS-S2 state of the heptameric Bcs1 AAA-ATPase Deposited 2024-09-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–456（456 aa） Chain B 1–456（456 aa） Chain C 1–456（456 aa） Chain D 1–456（456 aa） Chain E 1–456（456 aa） Chain F 1–456（456 aa） Chain G 1–456（456 aa）	Not recorded	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BCS1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 25–480； UniProt 1–456 Author chain B； PDBConstruct 25–480； UniProt 1–456 Author chain C； PDBConstruct 25–480； UniProt 1–456 Author chain D； PDBConstruct 25–480； UniProt 1–456 Author chain E； PDBConstruct 25–480； UniProt 1–456 Author chain F； PDBConstruct 25–480； UniProt 1–456 Author chain G； PDBConstruct 25–480； UniProt 1–456

Cytochrome b-c1 complex subunit Rieske, mitochondrial

Saccharomyces cerevisiae

UniProt P08067

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain H； UniProt 92–215	Not recorded	Mitochondrial chaperone BCS1 × 7 （P32839） FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.46 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9GS2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 31–215（185 aa） Fragment：RESIDUES 31-215	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain E 31–215（185 aa） Fragment：RESIDUES 31-215 Chain P 31–215（185 aa） Fragment：RESIDUES 31-215	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain E 31–215（185 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 31–215（185 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain E 31–215（185 aa） Fragment：UNP residues 31-215	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMX CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain C 1–215（215 aa） Chain c 1–215（215 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain C 1–215（215 aa） Chain c 1–215（215 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain E 1–215（215 aa） Chain O 1–215（215 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	UCRI_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–124； UniProt 92–215

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9gs2
Deposition date deposition_date	2024-09-13
Structure title title	Structure of the Rieske bound Apo1 state of the heptameric Bcs1 AAA-ATPase
Keywords keywords	Heptameric complex Iron-sulfur cluster substrate, TRANSLOCASE; TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	47.29 Å
Radius of gyration Rg (electron density) rg_electron	46.97 Å
Forward intensity I(0) i0	1432300000.00
Molecular weight molecular_weight	317710.0 kDa
Excluded volume excluded_volume	399140 Å³
Envelope volume envelope_volume	579980 Å³
Hydration-shell volume shell_volume	100190 Å³
Envelope diameter envelope_diameter	144.2 Å
Shell Rg shell_rg	54.24 Å
Envelope Rg envelope_rg	45.05 Å
Shape Rg shape_rg	46.95 Å
Total Rg total_rg	47.31 Å
Total atoms total_atoms	22365
Residues n_residues	2798
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	145.3 Å
Rg (real space) rg_real	46.88 Å
Rg uncertainty (real space) rg_real_error	1.07 Å
I(0) (real space) i0_real	1.4320e+09
I(0) uncertainty (real space) i0_real_error	2.8120e+07
Rg (reciprocal space) rg_reciprocal	47.29 Å
I(0) (reciprocal space) i0_reciprocal	1433000000.0000
Solution quality estimate total_estimate	0.8853
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	61.6 Å
Skewness Skewness skewness	0.013
Kurtosis Kurtosis kurtosis	-0.507
Angular range angular_range	— – 0.1650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	167700000.0000
Real-space data points n_real_points	34
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.888; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.950; Smooth: 0.890

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Mitochondrial chaperone BCS1
Molecular weight formula_weight	53826.1 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G
Atom count atom_count	22365

MGKHHHHHHGGGDYKDDDDKGSGHMSDKPIDIQYDKQATPNLSGVITPPTNETGNDSVREKLSKLVGDAMSNNPYFAAGGGLMILGTGLAVARSGIIKASRVLYRQMIVDLEIQSKDKSYAWFLTWMAKHPQRVSRHLSVRTNYIQHDNGSVSTKFSLVPGPGNHWIRYKGAFILIKRERSAKMIDIANGSPFETVTLTTLYRDKHLFDDILNEAKDIALKTTEGKTVIYTSFGPEWRKFGQPKAKRMLPSVILDSGIKEGILDDVYDFMKNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQALAGELDYNICILNLSENNLTDDRLNHLMNNMPERSILLLEDIDAAFNKRSQTGEQGFHSSVTFSGLLNALDGVTSSEETITFMTTNHPEKLDAAIMRPGRIDYKVFVGNATPYQVEKMFMKFYPGETDICKKFVNSVKELDITVSTAQLQGLFVMNKDAPHDALKMVSSLRNANHIF

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;brewer's yeast ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	13587.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;brewer's yeast ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (2)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.46 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	57257

fit	/app/data/saxs_computation/gs/9gs2/9gs2.fit
pddf	/app/data/pr_computation/gs/9gs2/9gs2.pr.out
profile	/app/data/saxs_computation/gs/9gs2/9gs2.dat

Structure of the Rieske bound Apo1 state of the heptameric Bcs1 AAA-ATPase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial chaperone BCS1

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)