8ec0

III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–457； UniProt 1–457 Author chain a； PDBConstruct 1–457； UniProt 1–457

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P07257

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–368； UniProt 1–368 Author chain b； PDBConstruct 1–368； UniProt 1–368

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P08067

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–215； UniProt 1–215 Author chain c； PDBConstruct 1–215； UniProt 1–215

Cytochrome b-c1 complex subunit 9, mitochondrial

OrganismNot specified

UniProt P22289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–66； UniProt 1–66 Author chain e； PDBConstruct 1–66； UniProt 1–66

Cytochrome b-c1 complex subunit 7, mitochondrial

OrganismNot specified

UniProt P00128

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–127； UniProt 1–127 Author chain f； PDBConstruct 1–127； UniProt 1–127

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P00127

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–147； UniProt 1–147 Author chain g； PDBConstruct 1–147； UniProt 1–147

Cytochrome b-c1 complex subunit 8, mitochondrial

OrganismNot specified

UniProt P08525

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–94； UniProt 1–94 Author chain h； PDBConstruct 1–94； UniProt 1–94

Cytochrome b

OrganismNot specified

UniProt P00163

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–385； UniProt 1–385 Author chain j； PDBConstruct 1–385； UniProt 1–385

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt P00401

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–534； UniProt 1–534

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P07143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–309； UniProt 1–309 Author chain l； PDBConstruct 1–309； UniProt 1–309

Cytochrome c oxidase subunit 8, mitochondrial

OrganismNot specified

UniProt P04039

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–78； UniProt 1–78

Cytochrome c oxidase subunit 7, mitochondrial

OrganismNot specified

UniProt P10174

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain N； PDBConstruct 1–60； UniProt 1–60

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–269； UniProt 1–269

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–251； UniProt 1–251

Cytochrome c oxidase subunit 6, mitochondrial

OrganismNot specified

UniProt P00427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–148； UniProt 1–148

Cytochrome c oxidase subunit 9, mitochondrial

OrganismNot specified

UniProt P07255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX9_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain R； PDBConstruct 1–59； UniProt 1–59

Cytochrome c oxidase subunit 13, mitochondrial

OrganismNot specified

UniProt P32799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX13_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain S； PDBConstruct 1–129； UniProt 1–129

Cytochrome c oxidase subunit 4, mitochondrial

OrganismNot specified

UniProt P04037

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX4_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain T； PDBConstruct 1–155； UniProt 1–155

Cytochrome c oxidase subunit 12, mitochondrial

OrganismNot specified

UniProt Q01519

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX12_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain U； PDBConstruct 1–83； UniProt 1–83

Cytochrome c oxidase subunit 26, mitochondrial

OrganismNot specified

UniProt Q2V2P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX26_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–66； UniProt 1–66

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00424

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b × 2 （P00163） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 PROTOPORPHYRIN IX CONTAINING FE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 COPPER (II) ION × 1 HEME-A × 2 DINUCLEAR COPPER ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–153； UniProt 1–153

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ec0
Deposition date deposition_date	2022-08-31
Structure title title	III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant
Keywords keywords	S.cerevisiae, respiratory supercomplex, phosphatidylglycerol, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ec0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ec0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ec0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.54 Å
Rg (electron density)	64.68 Å
Total Rg	64.61 Å
Atom count	46624
Residues	5688
Excluded volume	842470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ec0__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	50282.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	46624

MLRTVTSKTVSNQFKRSLATAVATPKAEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	40528.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MLSAARLQFAQGSVRRLTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	23394.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

MLGIRSSVKTCFKPMSLTSKRLISQSLLASKSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

Entity 4 Entity 4 polymer

Description description	Cytochrome b-c1 complex subunit 9, mitochondrial
Molecular weight formula_weight	7485.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDGDDDDE

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit 7, mitochondrial
Molecular weight formula_weight	14583.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	17276.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,g

MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDDDDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 8, mitochondrial
Molecular weight formula_weight	10987.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV

Entity 8 Entity 8 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43686.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

Entity 9 Entity 9 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	58832.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

Entity 10 Entity 10 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	34097.5 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITASTLLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 8, mitochondrial
Molecular weight formula_weight	8921.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 7, mitochondrial
Molecular weight formula_weight	6942.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	30383.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV

Entity 14 Entity 14 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	28585.1 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MLDLLRLQLTTFIMNDVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

Entity 15 Entity 15 polymer

Description description	Cytochrome c oxidase subunit 6, mitochondrial
Molecular weight formula_weight	17366.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS

Entity 16 Entity 16 polymer

Description description	Cytochrome c oxidase subunit 9, mitochondrial
Molecular weight formula_weight	6974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKKQEN

Entity 17 Entity 17 polymer

Description description	Cytochrome c oxidase subunit 13, mitochondrial
Molecular weight formula_weight	15046.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MFRQCAKRYASSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDD

Entity 18 Entity 18 polymer

Description description	Cytochrome c oxidase subunit 4, mitochondrial
Molecular weight formula_weight	17164.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH

Entity 19 Entity 19 polymer

Description description	Cytochrome c oxidase subunit 12, mitochondrial
Molecular weight formula_weight	9799.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD

Entity 20 Entity 20 polymer

Description description	Cytochrome c oxidase subunit 26, mitochondrial
Molecular weight formula_weight	7461.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKARKA

Entity 21 Entity 21 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	17161.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK

Entity 22 Entity 22 non-polymer

Description description	DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 23 Entity 23 non-polymer

Description description	(1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE
Molecular weight formula_weight	751.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 24 Entity 24 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 26 Entity 26 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 27 Entity 27 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	8ec0B01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	8ec0B02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	8ec0J01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	8ec0K01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	8ec0P01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	8ec0b01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	8ec0b02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	8ec0j01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

▶

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	745670

III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer