9etz

III2IV respiratory supercomplex from Saccharomyces cerevisiae

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–431； UniProt 27–457 Author chain L； PDBConstruct 1–431； UniProt 27–457

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P07257

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–352； UniProt 17–368 Author chain M； PDBConstruct 1–352； UniProt 17–368

Cytochrome b

OrganismNot specified

UniProt P00163

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–385； UniProt 1–385 Author chain N； PDBConstruct 1–385； UniProt 1–385

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P07143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–247； UniProt 62–308 Author chain O； PDBConstruct 1–247； UniProt 62–308

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P08067

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–185； UniProt 31–215 Author chain P； PDBConstruct 1–185； UniProt 31–215

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P00127

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–75； UniProt 73–147 Author chain Q； PDBConstruct 1–75； UniProt 73–147

Cytochrome b-c1 complex subunit 7, mitochondrial

OrganismNot specified

UniProt P00128

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–126； UniProt 2–127 Author chain R； PDBConstruct 1–126； UniProt 2–127

Cytochrome b-c1 complex subunit 8, mitochondrial

OrganismNot specified

UniProt P08525

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–93； UniProt 2–94 Author chain S； PDBConstruct 1–93； UniProt 2–94

Cytochrome b-c1 complex subunit 9, mitochondrial

OrganismNot specified

UniProt P22289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–57； UniProt 2–58 Author chain T； PDBConstruct 1–57； UniProt 2–58

Cytochrome b-c1 complex subunit 10, mitochondrial

OrganismNot specified

UniProt P37299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–76； UniProt 2–77 Author chain U； PDBConstruct 1–76； UniProt 2–77

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt P00401

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain a； PDBConstruct 1–534； UniProt 1–534

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain b； PDBConstruct 1–236； UniProt 16–251

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain c； PDBConstruct 1–269； UniProt 1–269

Cytochrome c oxidase subunit 4, mitochondrial

OrganismNot specified

UniProt P04037

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX4_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain d； PDBConstruct 1–120； UniProt 30–149

Cytochrome c oxidase subunit 6, mitochondrial

Saccharomyces cerevisiae

UniProt P00427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain f； PDBConstruct 1–102； UniProt 45–146

Cytochrome c oxidase subunit 7, mitochondrial

OrganismNot specified

UniProt P10174

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain g； PDBConstruct 1–59； UniProt 2–60

Cytochrome c oxidase subunit 8, mitochondrial

OrganismNot specified

UniProt P04039

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain h； PDBConstruct 1–51； UniProt 28–78

Cytochrome c oxidase subunit 9, mitochondrial

OrganismNot specified

UniProt P07255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX9_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain i； PDBConstruct 1–55； UniProt 2–56

Cytochrome c oxidase subunit 12, mitochondrial

OrganismNot specified

UniProt Q01519

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX12_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain j； PDBConstruct 1–75； UniProt 7–81

Cytochrome c oxidase subunit 13, mitochondrial

OrganismNot specified

UniProt P32799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX13_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain k； PDBConstruct 1–113； UniProt 13–125

Cytochrome c oxidase subunit 26, mitochondrial

OrganismNot specified

UniProt Q2V2P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX26_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain l； PDBConstruct 1–45； UniProt 22–66

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00424

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 2 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 2 （P37299） Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） CARDIOLIPIN × 11 PROTOPORPHYRIN IX CONTAINING FE × 4 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 COPPER (II) ION × 1 HEME-A × 2 CALCIUM ION × 1 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain e； PDBConstruct 1–133； UniProt 21–153

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9etz
Deposition date deposition_date	2024-03-27
Structure title title	III2IV respiratory supercomplex from Saccharomyces cerevisiae
Keywords keywords	Respiration, supercomplex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9etz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9etz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9etz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.76 Å
Rg (electron density)	64.92 Å
Total Rg	64.87 Å
Atom count	48784
Residues	5846
Excluded volume	883960 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9etz__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (36)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	47459.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	48795

AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	38751.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43686.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27678.2 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPR

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	20123.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	8983.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

EVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 7, mitochondrial
Molecular weight formula_weight	14452.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

PQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 8, mitochondrial
Molecular weight formula_weight	10856.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 9, mitochondrial
Molecular weight formula_weight	6535.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T

SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 10, mitochondrial
Molecular weight formula_weight	8471.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,U

AYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPLLGPTLEDHTPPEDKPN

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	58832.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26779.8 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

DVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	30383.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV

Entity 14 Entity 14 polymer

Description description	Cytochrome c oxidase subunit 4, mitochondrial
Molecular weight formula_weight	12947.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

VVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVP

Entity 15 Entity 15 polymer

Description description	Cytochrome c oxidase subunit 6, mitochondrial
Molecular weight formula_weight	12056.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

DEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 16 Entity 16 polymer

Description description	Cytochrome c oxidase subunit 7, mitochondrial
Molecular weight formula_weight	6811.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

ANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA

Entity 17 Entity 17 polymer

Description description	Cytochrome c oxidase subunit 8, mitochondrial
Molecular weight formula_weight	5737.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

VHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF

Entity 18 Entity 18 polymer

Description description	Cytochrome c oxidase subunit 9, mitochondrial
Molecular weight formula_weight	6471.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

TIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKK

Entity 19 Entity 19 polymer

Description description	Cytochrome c oxidase subunit 12, mitochondrial
Molecular weight formula_weight	8909.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

SPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDIN

Entity 20 Entity 20 polymer

Description description	Cytochrome c oxidase subunit 13, mitochondrial
Molecular weight formula_weight	13116.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

LPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHI

Entity 21 Entity 21 polymer

Description description	Cytochrome c oxidase subunit 26, mitochondrial
Molecular weight formula_weight	5088.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

GRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKARKA

Entity 22 Entity 22 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	14891.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

AQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK

Entity 23 Entity 23 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 24 Entity 24 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 25 Entity 25 non-polymer

Description description	DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	26

Entity 26 Entity 26 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 27 Entity 27 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 32 Entity 32 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 34 Entity 34 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 35 Entity 35 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 36 Entity 36 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	11

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	196457

III2IV respiratory supercomplex from Saccharomyces cerevisiae

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer