6ymx

CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–530； UniProt 5–534

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain b； PDBConstruct 1–236； UniProt 16–251

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain c； PDBConstruct 1–268； UniProt 2–269

Cytochrome c oxidase subunit 4, mitochondrial

OrganismNot specified

UniProt P04037

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–117； UniProt 30–146

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00424

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain e； PDBConstruct 1–128； UniProt 25–152

Cytochrome c oxidase subunit 6, mitochondrial

OrganismNot specified

UniProt P00427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–99； UniProt 47–145

Cytochrome c oxidase subunit 7, mitochondrial

OrganismNot specified

UniProt P10174

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain g； PDBConstruct 1–55； UniProt 3–57

Cytochrome c oxidase subunit 8, mitochondrial

OrganismNot specified

UniProt P04039

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain h； PDBConstruct 1–51； UniProt 28–78

Cytochrome c oxidase subunit 9, mitochondrial

OrganismNot specified

UniProt P07255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain i； PDBConstruct 1–53； UniProt 3–55

Cytochrome c oxidase subunit 12, mitochondrial

OrganismNot specified

UniProt Q01519

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX12_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain j； PDBConstruct 1–78； UniProt 6–83

Cytochrome c oxidase subunit 13, mitochondrial

OrganismNot specified

UniProt P32799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX13_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain k； PDBConstruct 1–114； UniProt 16–129

Cytochrome c oxidase subunit 26, mitochondrial

OrganismNot specified

UniProt Q2V2P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX26_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain m； PDBConstruct 1–38； UniProt 26–63

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

UniProt P07256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain A； PDBConstruct 1–431； UniProt 27–457 Author chain L； PDBConstruct 1–431； UniProt 27–457

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P07257

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain B； PDBConstruct 1–352； UniProt 17–368 Author chain M； PDBConstruct 1–352； UniProt 17–368

Cytochrome b

OrganismNot specified

UniProt P00163

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain C； PDBConstruct 1–385； UniProt 1–385 Author chain N； PDBConstruct 1–385； UniProt 1–385

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P07143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain D； PDBConstruct 1–248； UniProt 62–309 Author chain O； PDBConstruct 1–248； UniProt 62–309

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P08067

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain E； PDBConstruct 1–185； UniProt 31–215 Author chain P； PDBConstruct 1–185； UniProt 31–215

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P00127

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_YEAST
Isoform	—
PDB entities	18, 22
Chains and sequence ranges	Author chain F； PDBConstruct 1–74； UniProt 74–147 Author chain Q； PDBConstruct 1–75； UniProt 73–147

Cytochrome b-c1 complex subunit 7, mitochondrial

OrganismNot specified

UniProt P00128

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain G； PDBConstruct 1–126； UniProt 2–127 Author chain R； PDBConstruct 1–126； UniProt 2–127

Cytochrome b-c1 complex subunit 8, mitochondrial

OrganismNot specified

UniProt P08525

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain H； PDBConstruct 1–93； UniProt 2–94 Author chain S； PDBConstruct 1–93； UniProt 2–94

Cytochrome b-c1 complex subunit 9, mitochondrial

OrganismNot specified

UniProt P22289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_YEAST
Isoform	—
PDB entities	21, 23
Chains and sequence ranges	Author chain I； PDBConstruct 1–54； UniProt 5–58 Author chain T； PDBConstruct 1–54； UniProt 4–57

Cytochrome b-c1 complex subunit 10, mitochondrial

OrganismNot specified

UniProt P37299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） COPPER (II) ION × 1 HEME-A × 2 PHOSPHATIDYLETHANOLAMINE × 7 ;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ; × 2 DINUCLEAR COPPER ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZINC ION × 1 (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 PROTOPORPHYRIN IX CONTAINING FE × 6 (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_YEAST
Isoform	—
PDB entities	24, 25
Chains and sequence ranges	Author chain U； PDBConstruct 1–44； UniProt 10–53 Author chain V； PDBConstruct 1–51； UniProt 11–61

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ymx
Deposition date deposition_date	2020-04-10
Structure title title	CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae
Keywords keywords	Complex, CIII, CIV, Supercomplex, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ymx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ymx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ymx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.66 Å
Rg (electron density)	63.87 Å
Total Rg	63.87 Å
Atom count	47034
Residues	5759
Excluded volume	848890 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ymx__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	58316.9 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a
Atom count atom_count	47034

WLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

Entity 2 Entity 2 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26779.8 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

DVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

Entity 3 Entity 3 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	30252.4 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

THLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV

Entity 4 Entity 4 polymer

Description description	Cytochrome c oxidase subunit 4, mitochondrial
Molecular weight formula_weight	12694.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

VVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPV

Entity 5 Entity 5 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	14324.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

ALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQS

Entity 6 Entity 6 polymer

Description description	Cytochrome c oxidase subunit 6, mitochondrial
Molecular weight formula_weight	11725.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

ETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFP

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit 7, mitochondrial
Molecular weight formula_weight	6410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

NKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKA

Entity 8 Entity 8 polymer

Description description	Cytochrome c oxidase subunit 8, mitochondrial
Molecular weight formula_weight	5737.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

VHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF

Entity 9 Entity 9 polymer

Description description	Cytochrome c oxidase subunit 9, mitochondrial
Molecular weight formula_weight	6241.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

IAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERK

Entity 10 Entity 10 polymer

Description description	Cytochrome c oxidase subunit 12, mitochondrial
Molecular weight formula_weight	9225.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

NSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 13, mitochondrial
Molecular weight formula_weight	13306.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

NALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDD

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 26, mitochondrial
Molecular weight formula_weight	4347.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

ESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKA

Entity 13 Entity 13 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	47459.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L

AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW

Entity 14 Entity 14 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	38751.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL

Entity 15 Entity 15 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43686.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

Entity 16 Entity 16 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27807.4 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK

Entity 17 Entity 17 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	20123.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

Entity 18 Entity 18 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	8854.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 19 Entity 19 polymer

Description description	Cytochrome b-c1 complex subunit 7, mitochondrial
Molecular weight formula_weight	14452.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

PQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

Entity 20 Entity 20 polymer

Description description	Cytochrome b-c1 complex subunit 8, mitochondrial
Molecular weight formula_weight	10856.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV

Entity 21 Entity 21 polymer

Description description	Cytochrome b-c1 complex subunit 9, mitochondrial
Molecular weight formula_weight	6214.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

SLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA

Entity 22 Entity 22 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	8983.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

EVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 23 Entity 23 polymer

Description description	Cytochrome b-c1 complex subunit 9, mitochondrial
Molecular weight formula_weight	6230.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIA

Entity 24 Entity 24 polymer

Description description	Cytochrome b-c1 complex subunit 10, mitochondrial
Molecular weight formula_weight	4920.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

KTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQD

Entity 25 Entity 25 polymer

Description description	Cytochrome b-c1 complex subunit 10, mitochondrial
Molecular weight formula_weight	5750.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

TGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPL

Entity 26 Entity 26 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 29 Entity 29 non-polymer

Description description	;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ;
Molecular weight formula_weight	834.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 32 Entity 32 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	(1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate
Molecular weight formula_weight	592.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 35 Entity 35 non-polymer

Description description	(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 36 Entity 36 non-polymer

Description description	(5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate
Molecular weight formula_weight	634.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 37 Entity 37 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 38 Entity 38 non-polymer

Description description	(1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate
Molecular weight formula_weight	593.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 39 Entity 39 non-polymer

Description description	(1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate
Molecular weight formula_weight	564.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 40 Entity 40 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (28 domains)

Domain ID domain_id	d6ymxa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxa2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.25 — Cytochrome c oxidase subunit III-like
Superfamily Superfamily superfamily	f.25.1 — Cytochrome c oxidase subunit III-like
Family Family family	f.25.1.0 — automated matches

Domain ID domain_id	d6ymxd1
Class class	a — All alpha proteins
Fold Fold fold	a.3 — Cytochrome c
Superfamily Superfamily superfamily	a.3.1 — Cytochrome c
Family Family family	a.3.1.3 — Cytochrome bc1 domain

Domain ID domain_id	d6ymxd2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.11 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor
Family Family family	f.23.11.0 — automated matches

Domain ID domain_id	d6ymxe1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.0 — automated matches

Domain ID domain_id	d6ymxe2
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d6ymxf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.28 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.28.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.28.1.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.27 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.27.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.27.1.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxh_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.13 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.13.1 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxi_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.14 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.14.1 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxj_
Class class	a — All alpha proteins
Fold Fold fold	a.51 — Cytochrome c oxidase subunit h
Superfamily Superfamily superfamily	a.51.1 — Cytochrome c oxidase subunit h
Family Family family	a.51.1.0 — automated matches

Domain ID domain_id	d6ymxl1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxl2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxm1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxm2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxn1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.21 — Heme-binding four-helical bundle
Superfamily Superfamily superfamily	f.21.1 — Transmembrane di-heme cytochromes
Family Family family	f.21.1.2 — Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxn2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.32 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.32.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.32.1.0 — automated matches

Domain ID domain_id	d6ymxo1
Class class	a — All alpha proteins
Fold Fold fold	a.3 — Cytochrome c
Superfamily Superfamily superfamily	a.3.1 — Cytochrome c
Family Family family	a.3.1.3 — Cytochrome bc1 domain

Domain ID domain_id	d6ymxo2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.11 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor
Family Family family	f.23.11.0 — automated matches

Domain ID domain_id	d6ymxp1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.0 — automated matches

Domain ID domain_id	d6ymxp2
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d6ymxq_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.28 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.28.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.28.1.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxr_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.27 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.27.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.27.1.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxs_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.13 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.13.1 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxt_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.14 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.14.1 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

CATH v4.4 (4 domains)

Domain ID domain_id	6ymxE01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6ymxP01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6ymxa01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6ymxb01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.17 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	201223

CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5A, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 12, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer