6ymx

CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae

Method: ELECTRON MICROSCOPY D_max: 248.2 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain a； UniProt 5–534	Not recorded	Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GIQ Saccharomyces cerevisiae respiratory supercomplex III2IV Deposited 2018-05-15	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain a 1–534（534 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEC HEME C × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain a 1–534（534 aa） Chain m 1–534（534 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain a 1–534（534 aa） Chain n 1–534（534 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain a 1–534（534 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain a 5–534（530 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain a 1–534（534 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain a 1–534（534 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain K 1–534（534 aa） Chain k 1–534（534 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain K 1–534（534 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain a 1–534（534 aa） Chain m 1–534（534 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain a 1–534（534 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–530； UniProt 5–534

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00410

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain b； UniProt 16–251	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain b 16–251（236 aa） Chain n 16–251（236 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain b 16–251（236 aa） Chain o 16–251（236 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain b 16–251（236 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain b 16–251（236 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain b 16–251（236 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain b 16–251（236 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain P 1–251（251 aa） Chain p 1–251（251 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain P 1–251（251 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain b 1–251（251 aa） Chain n 1–251（251 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain b 16–251（236 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain b； PDBConstruct 1–236； UniProt 16–251

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00420

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain c； UniProt 2–269	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain c 1–269（269 aa） Chain o 1–269（269 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain c 1–269（269 aa） Chain p 1–269（269 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain c 1–269（269 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain c 2–269（268 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain c 1–269（269 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain c 1–269（269 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain O 1–269（269 aa） Chain o 1–269（269 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain O 1–269（269 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain c 1–269（269 aa） Chain o 1–269（269 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain c 1–269（269 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain c； PDBConstruct 1–268； UniProt 2–269

Cytochrome c oxidase subunit 4, mitochondrial

OrganismNot specified

UniProt P04037

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain d； UniProt 30–146	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1HR8 Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide Deposited 2000-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain O 2–25（24 aa） Fragment：RESIDUES 2-25	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.264
1HR8 Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide Deposited 2000-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 2–25（24 aa） Fragment：RESIDUES 2-25	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.264
1HR8 Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide Deposited 2000-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Q 2–25（24 aa） Fragment：RESIDUES 2-25	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.264
1HR8 Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide Deposited 2000-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 2–25（24 aa） Fragment：RESIDUES 2-25	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.264
1HR8 Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide Deposited 2000-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain O 2–25（24 aa） Fragment：RESIDUES 2-25 Chain P 2–25（24 aa） Fragment：RESIDUES 2-25 Chain Q 2–25（24 aa） Fragment：RESIDUES 2-25 Chain R 2–25（24 aa） Fragment：RESIDUES 2-25	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2 ZN ZINC ION × 4	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.264
2ODX Solution structure of Zn(II)Cox4 Deposited 2006-12-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 79–155（77 aa） Fragment：Cox4 subunit	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 6.9；298 K；Ionic strength (raw mmCIF value) 50 mM phosphate, 200 mM NaCl；Pressure 1 NMR sample composition 1 mM Zn(II)Cox4 U-15N, 50mM phosphate buffer NA, 200 mM NaCl, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM Zn(II)Cox4 U-15N,13C, 50mM phosphate buffer NA, 200 mM NaCl, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain d 26–155（130 aa） Chain p 26–155（130 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain d 26–155（130 aa） Chain q 26–155（130 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain d 26–155（130 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain d 30–146（117 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain d 29–149（121 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain d 26–155（130 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain T 1–155（155 aa） Chain t 1–155（155 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain T 1–155（155 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain d 1–155（155 aa） Chain p 1–155（155 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain d 30–149（120 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

12 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–117； UniProt 30–146

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00424

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain e； UniProt 25–152	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain e 21–153（133 aa） Chain q 21–153（133 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain e 25–152（128 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain e 21–153（133 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain e 21–153（133 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain W 1–153（153 aa） Chain w 1–153（153 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain W 1–153（153 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain e 1–153（153 aa） Chain q 1–153（153 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain e 21–153（133 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX5A_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain e； PDBConstruct 1–128； UniProt 25–152

Cytochrome c oxidase subunit 6, mitochondrial

OrganismNot specified

UniProt P00427

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain f； UniProt 47–145	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain f 41–148（108 aa） Chain r 41–148（108 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain f 41–148（108 aa） Chain s 41–148（108 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain f 41–148（108 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain f 47–145（99 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain f 45–148（104 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain f 41–148（108 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain Q 1–148（148 aa） Chain q 1–148（148 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain Q 1–148（148 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain f 1–148（148 aa） Chain r 1–148（148 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain f 45–146（102 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–99； UniProt 47–145

Cytochrome c oxidase subunit 7, mitochondrial

OrganismNot specified

UniProt P10174

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain g； UniProt 3–57	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain g 2–60（59 aa） Chain s 2–60（59 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain g 2–60（59 aa） Chain t 2–60（59 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain g 2–60（59 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain g 3–57（55 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain g 2–60（59 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain g 2–60（59 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain N 1–60（60 aa） Chain n 1–60（60 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain N 1–60（60 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain g 1–60（60 aa） Chain s 1–60（60 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain g 2–60（59 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain g； PDBConstruct 1–55； UniProt 3–57

Cytochrome c oxidase subunit 8, mitochondrial

OrganismNot specified

UniProt P04039

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain h； UniProt 28–78	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain h 28–74（47 aa） Chain t 28–74（47 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain h 28–78（51 aa） Chain u 28–78（51 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain h 28–78（51 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain h 28–78（51 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain h 28–74（47 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain h 28–78（51 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain M 1–78（78 aa） Chain m 1–78（78 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain M 1–78（78 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain G 27–78（52 aa） Chain Q 27–78（52 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain h 28–78（51 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain h； PDBConstruct 1–51； UniProt 28–78

Cytochrome c oxidase subunit 9, mitochondrial

OrganismNot specified

UniProt P07255

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain i； UniProt 3–55	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain i 2–56（55 aa） Chain u 2–56（55 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain i 2–56（55 aa） Chain v 2–56（55 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain i 2–56（55 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain i 2–53（52 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7Z10 Monomeric respiratory complex IV isolated from S. cerevisiae Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain i 2–56（55 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 3 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliters of sample applied to negatively glow discharged grig.	Resolution 3.87 Å
8DH6 Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs Deposited 2022-06-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain i 2–56（55 aa）	Not recorded	CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CU COPPER (II) ION × 2 HEA HEME-A × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 10 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain R 1–59（59 aa） Chain r 1–59（59 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 1–59（59 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain i 1–59（59 aa） Chain u 1–59（59 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain i 2–56（55 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain i； PDBConstruct 1–53； UniProt 3–55

Cytochrome c oxidase subunit 12, mitochondrial

OrganismNot specified

UniProt Q01519

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain j； UniProt 6–83	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain j 2–83（82 aa） Chain v 2–83（82 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain j 2–83（82 aa） Chain w 2–83（82 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain j 2–83（82 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain j 6–83（78 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain U 1–83（83 aa） Chain u 1–83（83 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain U 1–83（83 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain j 1–83（83 aa） Chain v 1–83（83 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain j 7–81（75 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX12_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain j； PDBConstruct 1–78； UniProt 6–83

Cytochrome c oxidase subunit 13, mitochondrial

OrganismNot specified

UniProt P32799

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain k； UniProt 16–129	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain k 10–129（120 aa） Chain w 10–129（120 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain k 10–129（120 aa） Chain x 10–129（120 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain k 10–129（120 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain k 16–129（114 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
6ZDB NMR structural analysis of yeast Cox13 reveals its C-terminus in interaction with ATP Deposited 2020-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–129（129 aa） Chain B 1–129（129 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；313.15 K；Ionic strength (raw mmCIF value) 20；Pressure 1 NMR sample composition 0.5 mM [U-15N] Cytochrome c oxidase subunit 13, Cox13, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-13C; U-15N] Cytochrome c oxidase subunit 13, Cox13, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM 50%[15N, 13C] mixed with 50% [14N, 12C] Cytochrome c oxidase subunit 13, Cox13, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain S 1–129（129 aa） Chain s 1–129（129 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain S 1–129（129 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain k 1–129（129 aa） Chain w 1–129（129 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain k 13–125（113 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX13_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain k； PDBConstruct 1–114； UniProt 16–129

Cytochrome c oxidase subunit 26, mitochondrial

OrganismNot specified

UniProt Q2V2P9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain m； UniProt 26–63	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain l 1–66（66 aa） Chain x 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain l 1–66（66 aa） Chain y 1–66（66 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain l 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
6YMY Cytochrome c oxidase from Saccharomyces cerevisiae Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain m 26–63（38 aa）	Not recorded	CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 3 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain V 1–66（66 aa） Chain v 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain V 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain l 1–66（66 aa） Chain x 1–66（66 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain l 22–66（45 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COX26_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain m； PDBConstruct 1–38； UniProt 26–63

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

UniProt P07256

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain A； UniProt 27–457 Chain L； UniProt 27–457	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EZV STRUCTURE OF THE YEAST CYTOCHROME BC1 COMPLEX CO-CRYSTALLIZED WITH AN ANTIBODY FV-FRAGMENT Deposited 2000-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain A 27–457（431 aa） Fragment：RESIDUES 24-457	Not recorded	HEM PROTOPORPHYRIN IX CONTAINING FE × 4 SMA STIGMATELLIN A × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions microseeding；pH 8；277 K；5 % PEG 4000, 100 mM Tris, 0.05 % Undecyl-maltoside, 1 micromolar stigmatellin, pH 8.0, microseeding, temperature 277K	Resolution 2.30 Å R-free 0.254
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 24–454（431 aa） Fragment：RESIDUES 27-457	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain A 27–457（431 aa） Fragment：RESIDUES 27-457 Chain L 27–457（431 aa） Fragment：RESIDUES 27-457	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 27–457（431 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 27–457（431 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain A 27–457（431 aa） Chain L 27–457（431 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain A 27–457（431 aa） Chain L 27–457（431 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 27–457（431 aa） Fragment：UNP residues 27-457	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain A 27–457（431 aa） Chain L 27–457（431 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain A 27–457（431 aa） Chain L 27–457（431 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain A 27–457（431 aa） Chain L 27–457（431 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain A 1–457（457 aa） Chain a 1–457（457 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–457（457 aa） Chain a 1–457（457 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain A 1–457（457 aa） Chain K 1–457（457 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain A 27–457（431 aa） Chain L 27–457（431 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR1_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain A； PDBConstruct 1–431； UniProt 27–457 Author chain L； PDBConstruct 1–431； UniProt 27–457

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P07257

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain B； UniProt 17–368 Chain M； UniProt 17–368	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 17–368（352 aa） Fragment：RESIDUES 17-368	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain B 17–368（352 aa） Fragment：RESIDUES 17-368 Chain M 17–368（352 aa） Fragment：RESIDUES 17-368	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 17–368（352 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 17–368（352 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain B 17–368（352 aa） Chain M 17–368（352 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain B 17–368（352 aa） Chain M 17–368（352 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain B 17–368（352 aa） Fragment：UNP residues 17-368	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain B 17–368（352 aa） Chain M 17–368（352 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain B 17–368（352 aa） Chain M 17–368（352 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain B 17–368（352 aa） Chain M 17–368（352 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain B 1–368（368 aa） Chain b 1–368（368 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain B 1–368（368 aa） Chain b 1–368（368 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain B 1–368（368 aa） Chain L 1–368（368 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 17–368（352 aa） Chain M 17–368（352 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR2_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain B； PDBConstruct 1–352； UniProt 17–368 Author chain M； PDBConstruct 1–352； UniProt 17–368

Cytochrome b

OrganismNot specified

UniProt P00163

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain C； UniProt 1–385 Chain N； UniProt 1–385	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 1–385（385 aa）	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain C 1–385（385 aa） Chain N 1–385（385 aa）	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 1–385（385 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 1–385（385 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain C 1–385（385 aa） Chain N 1–385（385 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain C 1–385（385 aa） Chain N 1–385（385 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain C 1–385（385 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain C 1–385（385 aa） Chain N 1–385（385 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain C 1–385（385 aa） Chain N 1–385（385 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain C 1–385（385 aa） Chain N 1–385（385 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain J 1–385（385 aa） Chain j 1–385（385 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain J 1–385（385 aa） Chain j 1–385（385 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain C 1–385（385 aa） Chain M 1–385（385 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain C 1–385（385 aa） Chain N 1–385（385 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CYB_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain C； PDBConstruct 1–385； UniProt 1–385 Author chain N； PDBConstruct 1–385； UniProt 1–385

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P07143

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain D； UniProt 62–309 Chain O； UniProt 62–309	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 62–307（246 aa） Fragment：RESIDUES 62-307	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain D 62–309（248 aa） Fragment：RESIDUES 62-309 Chain O 62–309（248 aa） Fragment：RESIDUES 62-309	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain D 62–307（246 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 62–309（248 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain D 62–309（248 aa） Chain O 62–309（248 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain D 62–309（248 aa） Chain O 62–309（248 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain D 62–309（248 aa） Fragment：UNP residues 62-309	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain D 62–309（248 aa） Chain O 62–309（248 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain D 62–309（248 aa） Chain O 62–309（248 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain D 62–309（248 aa） Chain O 62–309（248 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain L 1–309（309 aa） Chain l 1–309（309 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain L 1–309（309 aa） Chain l 1–309（309 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain D 1–309（309 aa） Chain N 1–309（309 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain D 62–308（247 aa） Chain O 62–308（247 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CY1_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain D； PDBConstruct 1–248； UniProt 62–309 Author chain O； PDBConstruct 1–248； UniProt 62–309

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P08067

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain E； UniProt 31–215 Chain P； UniProt 31–215	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 31–215（185 aa） Fragment：RESIDUES 31-215	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain E 31–215（185 aa） Fragment：RESIDUES 31-215 Chain P 31–215（185 aa） Fragment：RESIDUES 31-215	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain E 31–215（185 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 31–215（185 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain E 31–215（185 aa） Fragment：UNP residues 31-215	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain C 1–215（215 aa） Chain c 1–215（215 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain C 1–215（215 aa） Chain c 1–215（215 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain E 1–215（215 aa） Chain O 1–215（215 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain E 31–215（185 aa） Chain P 31–215（185 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
9GS2 Structure of the Rieske bound Apo1 state of the heptameric Bcs1 AAA-ATPase Deposited 2024-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain H 92–215（124 aa）	Not recorded	FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	UCRI_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain E； PDBConstruct 1–185； UniProt 31–215 Author chain P； PDBConstruct 1–185； UniProt 31–215

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P00127

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain F； UniProt 74–147 Chain Q； UniProt 73–147	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain F 74–147（74 aa） Fragment：RESIDUES 74-147	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain F 75–147（73 aa） Fragment：RESIDUES 74-147 Chain Q 75–147（73 aa） Fragment：RESIDUES 74-147	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain F 74–147（74 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 74–147（74 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain F 2–147（146 aa） Fragment：RESIDUES 2-147 Chain Q 2–147（146 aa） Fragment：RESIDUES 2-147	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain F 2–147（146 aa） Fragment：RESIDUES 2-147 Chain Q 2–147（146 aa） Fragment：RESIDUES 2-147	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain F 74–147（74 aa） Fragment：UNP residues 74-147	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain F 1–147（147 aa） Chain Q 1–147（147 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain F 1–147（147 aa） Chain Q 1–147（147 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain F 1–147（147 aa） Chain Q 1–147（147 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain G 1–147（147 aa） Chain g 1–147（147 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain G 1–147（147 aa） Chain g 1–147（147 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8ZJC Cryo-EM structure of Saccharomyces cerevisiae bc1 complex Deposited 2024-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain F 73–147（75 aa） Chain Q 73–147（75 aa）	Not recorded	UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8ZMT Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in Metyltetraprole-bound state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain F 73–147（75 aa） Chain Q 73–147（75 aa）	Not recorded	A1D6P 1-[2-[[1-(4-chlorophenyl)pyrazol-3-yl]oxymethyl]-3-methyl-phenyl]-4-methyl-1,2,3,4-tetrazol-5-one × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 3 FES FE2/S2 (INORGANIC) CLUSTER × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS, 0.1% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain F 1–147（147 aa） Chain P 1–147（147 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain F 73–147（75 aa） Chain Q 73–147（75 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR6_YEAST
Isoform	—
PDB entities	18, 22
Chains and sequence ranges	Author chain F； PDBConstruct 1–74； UniProt 74–147 Author chain Q； PDBConstruct 1–75； UniProt 73–147

Cytochrome b-c1 complex subunit 7, mitochondrial

OrganismNot specified

UniProt P00128

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain G； UniProt 2–127 Chain R； UniProt 2–127	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 3–127（125 aa） Fragment：RESIDUES 3-127	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain G 2–127（126 aa） Fragment：RESIDUES 2-127 Chain R 2–127（126 aa） Fragment：RESIDUES 2-127	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 3–127（125 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain F 1–127（127 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain G 2–127（126 aa） Fragment：RESIDUES 2-127 Chain R 2–127（126 aa） Fragment：RESIDUES 2-127	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain G 2–127（126 aa） Fragment：RESIDUES 2-127 Chain R 2–127（126 aa） Fragment：RESIDUES 2-127	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain G 2–127（126 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain G 1–127（127 aa） Chain R 1–127（127 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain G 1–127（127 aa） Chain R 1–127（127 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain G 1–127（127 aa） Chain R 1–127（127 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain F 1–127（127 aa） Chain f 1–127（127 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain F 1–127（127 aa） Chain f 1–127（127 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain G 1–127（127 aa） Chain Q 1–127（127 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain G 2–127（126 aa） Chain R 2–127（126 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR7_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain G； PDBConstruct 1–126； UniProt 2–127 Author chain R； PDBConstruct 1–126； UniProt 2–127

Cytochrome b-c1 complex subunit 8, mitochondrial

OrganismNot specified

UniProt P08525

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain H； UniProt 2–94 Chain S； UniProt 2–94	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 2–94（93 aa） Fragment：RESIDUES 2-94	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain H 2–94（93 aa） Fragment：RESIDUES 2-94 Chain S 2–94（93 aa） Fragment：RESIDUES 2-94	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain H 2–94（93 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 1–94（94 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain H 2–94（93 aa） Chain S 2–94（93 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain H 2–94（93 aa） Chain S 2–94（93 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain H 2–94（93 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain H 2–94（93 aa） Chain S 2–94（93 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain H 1–94（94 aa） Chain S 1–94（94 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain H 1–94（94 aa） Chain S 1–94（94 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain H 1–94（94 aa） Chain h 1–94（94 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain H 1–94（94 aa） Chain h 1–94（94 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain H 1–94（94 aa） Chain R 1–94（94 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain H 2–94（93 aa） Chain S 2–94（93 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR8_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain H； PDBConstruct 1–93； UniProt 2–94 Author chain S； PDBConstruct 1–93； UniProt 2–94

Cytochrome b-c1 complex subunit 9, mitochondrial

OrganismNot specified

UniProt P22289

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain I； UniProt 5–58 Chain T； UniProt 4–57	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） Cytochrome b-c1 complex subunit 10, mitochondrial × 1 （P37299） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EZV STRUCTURE OF THE YEAST CYTOCHROME BC1 COMPLEX CO-CRYSTALLIZED WITH AN ANTIBODY FV-FRAGMENT Deposited 2000-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 4–58（55 aa） Fragment：RESIDUES 4-58	Not recorded	HEM PROTOPORPHYRIN IX CONTAINING FE × 4 SMA STIGMATELLIN A × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions microseeding；pH 8；277 K；5 % PEG 4000, 100 mM Tris, 0.05 % Undecyl-maltoside, 1 micromolar stigmatellin, pH 8.0, microseeding, temperature 277K	Resolution 2.30 Å R-free 0.254
1KB9 YEAST CYTOCHROME BC1 COMPLEX Deposited 2001-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 4–58（55 aa） Fragment：RESIDUES 4-58	Not recorded	PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 1 UMQ UNDECYL-MALTOSIDE × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 3 SMA STIGMATELLIN A × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 PIE 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoinositol × 1 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 CDL CARDIOLIPIN × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；PEG4000, pH 8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.30 Å R-free 0.249
1KYO YEAST CYTOCHROME BC1 COMPLEX WITH BOUND SUBSTRATE CYTOCHROME C Deposited 2002-02-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain I 1–57（57 aa） Fragment：RESIDUES 1-57 Chain T 1–57（57 aa） Fragment：RESIDUES 1-57	Not recorded	HEC HEME C × 7 SMA STIGMATELLIN A × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG4000, 20 mM Tris, 0.05 % Undecyl-maltopyranoside, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.97 Å R-free 0.268
1P84 HDBT inhibited Yeast Cytochrome bc1 Complex Deposited 2003-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain I 3–57（55 aa）	Not recorded	3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 UMQ UNDECYL-MALTOSIDE × 2 HEC HEME C × 6 DBT 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 CDL CARDIOLIPIN × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
2IBZ Yeast Cytochrome BC1 Complex with Stigmatellin Deposited 2006-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 0–65（66 aa）	Not recorded	HEC HEME C × 3 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 SMA STIGMATELLIN A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；precipitant PEG4000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.256
3CX5 Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer. Deposited 2008-04-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain I 2–66（65 aa） Fragment：RESIDUES 2-66 Chain T 2–66（65 aa） Fragment：RESIDUES 2-66	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (paraffin oil), temperature 277K	Resolution 1.90 Å R-free 0.263
3CXH Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer. Deposited 2008-04-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 23 PDB declaration: 23-meric	Chain I 2–66（65 aa） Fragment：RESIDUES 2-66 Chain T 2–66（65 aa） Fragment：RESIDUES 2-66	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 7 SMA STIGMATELLIN A × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN6 (2R,5R,11S,14R)-2-(butanoyloxy)-5,8,11-trihydroxy-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions Microbatch (Paraffin oil)；pH 7.5；277 K；1M Sucrose, 10% DMSO, 20mM Tris pH 7.5, 80mM NaCl, 0.05 % UM, 1 M stigmatellin, 5% PEG 4000, Microbatch (Paraffin oil), temperature 277K	Resolution 2.50 Å R-free 0.256
4PD4 Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Deposited 2014-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain I 2–58（57 aa） Fragment：UNP residues 2-58	Not recorded	UMQ UNDECYL-MALTOSIDE × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 6 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 AOQ 2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277.2 K；polyethylene glycol 4000, DMSO, Sucrose, Potassium phosphate, n-undecyl-?-D-maltopyranoside, atovaquone	Resolution 3.04 Å R-free 0.297
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain I 1–66（66 aa） Chain T 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain I 1–66（66 aa） Chain T 1–66（66 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain I 1–66（66 aa） Chain T 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain E 1–66（66 aa） Chain e 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EC0 III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant Deposited 2022-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain E 1–66（66 aa） Chain e 1–66（66 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 15 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CUA DINUCLEAR COPPER ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8YHQ Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in pyraclostrobin-bound state Deposited 2024-02-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 4–58（55 aa） Chain R 4–58（55 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 A1D6K methyl ~{N}-[2-[[1-(4-chlorophenyl)pyrazol-3-yl]oxymethyl]phenyl]-~{N}-methoxy-carbamate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.42 Å
8YIL Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state Deposited 2024-02-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 4–58（55 aa） Chain T 4–58（55 aa）	Not recorded	UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 86T metyltetraprole × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å
8YIN Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state Deposited 2024-02-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 4–58（55 aa） Chain T 4–58（55 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 A1D6O 1-[2-[(4,6-dimethyl-1,3-benzothiazol-2-yl)sulfanylmethyl]-3-methyl-phenyl]-4-methyl-1,2,3,4-tetrazol-5-one × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS, 0.1% DDM cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.74 Å
8YIO Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state Deposited 2024-02-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 4–58（55 aa） Chain T 4–58（55 aa）	Not recorded	AZO METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.35 Å
8ZJC Cryo-EM structure of Saccharomyces cerevisiae bc1 complex Deposited 2024-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 4–58（55 aa） Chain T 4–58（55 aa）	Not recorded	UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8ZMT Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in Metyltetraprole-bound state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 4–58（55 aa） Chain T 4–58（55 aa）	Not recorded	A1D6P 1-[2-[[1-(4-chlorophenyl)pyrazol-3-yl]oxymethyl]-3-methyl-phenyl]-4-methyl-1,2,3,4-tetrazol-5-one × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 3 FES FE2/S2 (INORGANIC) CLUSTER × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS, 0.1% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain I 1–66（66 aa） Chain S 1–66（66 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain I 2–58（57 aa） Chain T 2–58（57 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR9_YEAST
Isoform	—
PDB entities	21, 23
Chains and sequence ranges	Author chain I； PDBConstruct 1–54； UniProt 5–58 Author chain T； PDBConstruct 1–54； UniProt 4–57

Cytochrome b-c1 complex subunit 10, mitochondrial

OrganismNot specified

UniProt P37299

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 32 PDB declaration: 32-meric（32） Consistent with protein copy count	Chain U； UniProt 10–53 Chain V； UniProt 11–61	Not recorded	Cytochrome c oxidase subunit 1 × 1 （P00401） Cytochrome c oxidase subunit 2 × 1 （P00410） Cytochrome c oxidase subunit 3 × 1 （P00420） Cytochrome c oxidase subunit 4, mitochondrial × 1 （P04037） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00424） Cytochrome c oxidase subunit 6, mitochondrial × 1 （P00427） Cytochrome c oxidase subunit 7, mitochondrial × 1 （P10174） Cytochrome c oxidase subunit 8, mitochondrial × 1 （P04039） Cytochrome c oxidase subunit 9, mitochondrial × 1 （P07255） Cytochrome c oxidase subunit 12, mitochondrial × 1 （Q01519） Cytochrome c oxidase subunit 13, mitochondrial × 1 （P32799） Cytochrome c oxidase subunit 26, mitochondrial × 1 （Q2V2P9） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P07256） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P07257） Cytochrome b × 2 （P00163） Cytochrome c1, heme protein, mitochondrial × 2 （P07143） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P08067） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 7, mitochondrial × 2 （P00128） Cytochrome b-c1 complex subunit 8, mitochondrial × 2 （P08525） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） Cytochrome b-c1 complex subunit 6, mitochondrial × 1 （P00127） Cytochrome b-c1 complex subunit 9, mitochondrial × 1 （P22289） CU COPPER (II) ION × 1 HEA HEME-A × 2 PTY PHOSPHATIDYLETHANOLAMINE × 7 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 CUA DINUCLEAR COPPER ION × 1 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 5 ZN ZINC ION × 1 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.17 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6YMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HU9 III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae Deposited 2018-10-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain J 1–77（77 aa） Chain U 1–77（77 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 28 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 1 CDL CARDIOLIPIN × 8 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 4 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microL of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 sec	Resolution 3.35 Å
6T0B The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae Deposited 2019-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain J 1–77（77 aa） Chain U 1–77（77 aa）	Not recorded	CDL CARDIOLIPIN × 8 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 7 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 2 HEA HEME-A × 4 CA CALCIUM ION × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 2.80 Å
6T15 The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae Deposited 2019-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 1–77（77 aa） Chain U 1–77（77 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 CDL CARDIOLIPIN × 7 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter of sample applied to negatively glow discharged grid, blot force -10; blotting time 8.5 s	Resolution 3.29 Å
8E7S III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6 Deposited 2022-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 44 PDB declaration: 44-meric	Chain D 1–77（77 aa） Chain d 1–77（77 aa）	Not recorded	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 24 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 10 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEA HEME-A × 4 CU COPPER (II) ION × 2 CUA DINUCLEAR COPPER ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8YHQ Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in pyraclostrobin-bound state Deposited 2024-02-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain S 10–61（52 aa） Chain T 10–61（52 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 A1D6K methyl ~{N}-[2-[[1-(4-chlorophenyl)pyrazol-3-yl]oxymethyl]phenyl]-~{N}-methoxy-carbamate × 2 7PH (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.42 Å
8YIL Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state Deposited 2024-02-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain U 10–61（52 aa） Chain V 10–61（52 aa）	Not recorded	UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 86T metyltetraprole × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å
8YIN Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state Deposited 2024-02-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain U 10–61（52 aa） Chain V 10–61（52 aa）	Not recorded	6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 A1D6O 1-[2-[(4,6-dimethyl-1,3-benzothiazol-2-yl)sulfanylmethyl]-3-methyl-phenyl]-4-methyl-1,2,3,4-tetrazol-5-one × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS, 0.1% DDM cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.74 Å
8YIO Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state Deposited 2024-02-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain U 10–61（52 aa） Chain V 10–61（52 aa）	Not recorded	AZO METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATE × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.35 Å
8ZJC Cryo-EM structure of Saccharomyces cerevisiae bc1 complex Deposited 2024-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain U 10–61（52 aa） Chain V 10–61（52 aa）	Not recorded	UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS,0.1%DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8ZMT Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in Metyltetraprole-bound state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain U 10–61（52 aa） Chain V 10–61（52 aa）	Not recorded	A1D6P 1-[2-[[1-(4-chlorophenyl)pyrazol-3-yl]oxymethyl]-3-methyl-phenyl]-4-methyl-1,2,3,4-tetrazol-5-one × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 6 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 3 FES FE2/S2 (INORGANIC) CLUSTER × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS, 0.1% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.52 Å
9BPB Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae Deposited 2024-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 42-meric	Chain J 1–77（77 aa） Chain T 1–77（77 aa）	Not recorded	CDL CARDIOLIPIN × 8 6PH (1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate × 2 8PE (2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate × 2 CN5 (5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate × 1 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 9PE (1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate × 2 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 6 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 8 PTY PHOSPHATIDYLETHANOLAMINE × 10 HEA HEME-A × 4 CU COPPER (II) ION × 2 CA CALCIUM ION × 2 CN3 (2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample, 5 s blot time, 30 s hold time, 0 blot force.	Resolution 2.57 Å
9ETZ III2IV respiratory supercomplex from Saccharomyces cerevisiae Deposited 2024-03-27	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain J 2–77（76 aa） Chain U 2–77（76 aa）	Not recorded	CDL CARDIOLIPIN × 11 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 26 PCF 1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE × 6 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 CU COPPER (II) ION × 1 HEA HEME-A × 2 CA CALCIUM ION × 1 MG MAGNESIUM ION × 1 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	QCR10_YEAST
Isoform	—
PDB entities	24, 25
Chains and sequence ranges	Author chain U； PDBConstruct 1–44； UniProt 10–53 Author chain V； PDBConstruct 1–51； UniProt 11–61

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ymx
Deposition date deposition_date	2020-04-10
Structure title title	CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae
Keywords keywords	Complex, CIII, CIV, Supercomplex, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	64.66 Å
Radius of gyration Rg (electron density) rg_electron	63.87 Å
Forward intensity I(0) i0	5492840000.00
Molecular weight molecular_weight	666490.0 kDa
Excluded volume excluded_volume	848890 Å³
Envelope volume envelope_volume	1228800 Å³
Hydration-shell volume shell_volume	155920 Å³
Envelope diameter envelope_diameter	225.8 Å
Shell Rg shell_rg	68.02 Å
Envelope Rg envelope_rg	62.73 Å
Shape Rg shape_rg	63.89 Å
Total Rg total_rg	63.87 Å
Total atoms total_atoms	47034
Residues n_residues	5759
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	248.2 Å
Rg (real space) rg_real	68.63 Å
Rg uncertainty (real space) rg_real_error	1.57 Å
I(0) (real space) i0_real	5.5490e+09
I(0) uncertainty (real space) i0_real_error	1.1270e+08
Rg (reciprocal space) rg_reciprocal	64.73 Å
I(0) (reciprocal space) i0_reciprocal	5494000000.0000
Solution quality estimate total_estimate	0.6460
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	72.4 Å
Skewness Skewness skewness	0.612
Kurtosis Kurtosis kurtosis	0.361
Angular range angular_range	— – 0.1200 Å⁻¹
Current regularization parameter α current_alpha	0.8079
Highest regularization parameter α highest_alpha	551900000.0000
Real-space data points n_real_points	25
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.700; Stabil: 0.849; Sysdev: 0.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.847

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	58316.9 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a
Atom count atom_count	47034

WLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS

Entity 2 Entity 2 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26779.8 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

DVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

Entity 3 Entity 3 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	30252.4 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

THLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV

Entity 4 Entity 4 polymer

Description description	Cytochrome c oxidase subunit 4, mitochondrial
Molecular weight formula_weight	12694.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

VVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPV

Entity 5 Entity 5 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	14324.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

ALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQS

Entity 6 Entity 6 polymer

Description description	Cytochrome c oxidase subunit 6, mitochondrial
Molecular weight formula_weight	11725.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

ETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFP

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit 7, mitochondrial
Molecular weight formula_weight	6410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

NKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKA

Entity 8 Entity 8 polymer

Description description	Cytochrome c oxidase subunit 8, mitochondrial
Molecular weight formula_weight	5737.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

VHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF

Entity 9 Entity 9 polymer

Description description	Cytochrome c oxidase subunit 9, mitochondrial
Molecular weight formula_weight	6241.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

IAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERK

Entity 10 Entity 10 polymer

Description description	Cytochrome c oxidase subunit 12, mitochondrial
Molecular weight formula_weight	9225.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

NSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 13, mitochondrial
Molecular weight formula_weight	13306.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

NALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDD

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 26, mitochondrial
Molecular weight formula_weight	4347.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

ESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKA

Entity 13 Entity 13 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	47459.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L

AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW

Entity 14 Entity 14 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	38751.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL

Entity 15 Entity 15 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43686.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

Entity 16 Entity 16 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27807.4 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK

Entity 17 Entity 17 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	20123.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG

Entity 18 Entity 18 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	8854.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 19 Entity 19 polymer

Description description	Cytochrome b-c1 complex subunit 7, mitochondrial
Molecular weight formula_weight	14452.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

PQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

Entity 20 Entity 20 polymer

Description description	Cytochrome b-c1 complex subunit 8, mitochondrial
Molecular weight formula_weight	10856.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV

Entity 21 Entity 21 polymer

Description description	Cytochrome b-c1 complex subunit 9, mitochondrial
Molecular weight formula_weight	6214.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

SLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA

Entity 22 Entity 22 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	8983.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

EVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK

Entity 23 Entity 23 polymer

Description description	Cytochrome b-c1 complex subunit 9, mitochondrial
Molecular weight formula_weight	6230.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIA

Entity 24 Entity 24 polymer

Description description	Cytochrome b-c1 complex subunit 10, mitochondrial
Molecular weight formula_weight	4920.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

KTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQD

Entity 25 Entity 25 polymer

Description description	Cytochrome b-c1 complex subunit 10, mitochondrial
Molecular weight formula_weight	5750.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

TGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPL

Entity 26 Entity 26 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 29 Entity 29 non-polymer

Description description	;(2R,5S,11R,14R)-5,8,11-trihydroxy-2-(nonanoyloxy)-5,11-dioxido-16-oxo-14-[(propanoyloxy)methyl]-4,6,10,12,15-pentaoxa-5,11-diphosphanonadec-1-yl undecanoate ;
Molecular weight formula_weight	834.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSHOCHOLINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 32 Entity 32 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	(1R)-2-(phosphonooxy)-1-[(tridecanoyloxy)methyl]ethyl pentadecanoate
Molecular weight formula_weight	592.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 35 Entity 35 non-polymer

Description description	(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl octadecanoate
Molecular weight formula_weight	692.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 36 Entity 36 non-polymer

Description description	(5S,11R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-4,6,10,12,16-pentaoxa-5,11-diphosphaoctadec-1-yl pentadecanoate
Molecular weight formula_weight	634.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 37 Entity 37 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 38 Entity 38 non-polymer

Description description	(1R)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(heptanoyloxy)methyl]ethyl octadecanoate
Molecular weight formula_weight	593.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 39 Entity 39 non-polymer

Description description	(1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate
Molecular weight formula_weight	564.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 40 Entity 40 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▼

7. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (28 domains)

Domain ID domain_id	d6ymxa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxa2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.25 — Cytochrome c oxidase subunit III-like
Superfamily Superfamily superfamily	f.25.1 — Cytochrome c oxidase subunit III-like
Family Family family	f.25.1.0 — automated matches

Domain ID domain_id	d6ymxd1
Class class	a — All alpha proteins
Fold Fold fold	a.3 — Cytochrome c
Superfamily Superfamily superfamily	a.3.1 — Cytochrome c
Family Family family	a.3.1.3 — Cytochrome bc1 domain

Domain ID domain_id	d6ymxd2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.11 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor
Family Family family	f.23.11.0 — automated matches

Domain ID domain_id	d6ymxe1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.0 — automated matches

Domain ID domain_id	d6ymxe2
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d6ymxf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.28 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.28.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.28.1.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.27 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.27.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.27.1.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxh_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.13 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.13.1 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxi_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.14 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.14.1 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxj_
Class class	a — All alpha proteins
Fold Fold fold	a.51 — Cytochrome c oxidase subunit h
Superfamily Superfamily superfamily	a.51.1 — Cytochrome c oxidase subunit h
Family Family family	a.51.1.0 — automated matches

Domain ID domain_id	d6ymxl1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxl2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxm1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxm2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d6ymxn1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.21 — Heme-binding four-helical bundle
Superfamily Superfamily superfamily	f.21.1 — Transmembrane di-heme cytochromes
Family Family family	f.21.1.2 — Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxn2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.32 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.32.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.32.1.0 — automated matches

Domain ID domain_id	d6ymxo1
Class class	a — All alpha proteins
Fold Fold fold	a.3 — Cytochrome c
Superfamily Superfamily superfamily	a.3.1 — Cytochrome c
Family Family family	a.3.1.3 — Cytochrome bc1 domain

Domain ID domain_id	d6ymxo2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.11 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor
Family Family family	f.23.11.0 — automated matches

Domain ID domain_id	d6ymxp1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.0 — automated matches

Domain ID domain_id	d6ymxp2
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d6ymxq_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.28 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.28.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.28.1.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxr_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.27 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.27.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.27.1.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxs_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.13 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.13.1 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d6ymxt_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.14 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.14.1 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

CATH v4.4 (4 domains)

Domain ID domain_id	6ymxE01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6ymxP01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	6ymxa01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6ymxb01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.17 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	201223

fit	/app/data/saxs_computation/ym/6ymx/6ymx.fit
pddf	/app/data/pr_computation/ym/6ymx/6ymx.pr.out
profile	/app/data/saxs_computation/ym/6ymx/6ymx.dat

CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 5A, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 12, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 13, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c oxidase subunit 26, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Cytochrome b-c1 complex subunit 10, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Polymer Polymer