8ebv

Initial DNA-lesion (AP) binding by XPC and TFIIH complex 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

TFIIH basal transcription factor complex helicase XPB subunit

Homo sapiens

UniProt P19447

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERCC3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–782； UniProt 1–782

General transcription and DNA repair factor IIH helicase subunit XPD

Homo sapiens

UniProt P18074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERCC2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–760； UniProt 1–760

General transcription factor IIH subunit 1

Homo sapiens

UniProt P32780

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–548； UniProt 1–548

General transcription factor IIH subunit 4, p52

Homo sapiens

UniProt Q92759

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–462； UniProt 1–462

General transcription factor IIH subunit 2

Homo sapiens

UniProt Q13888

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 23–417； UniProt 1–395

General transcription factor IIH subunit 3

Homo sapiens

UniProt Q13889

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–308； UniProt 1–308

General transcription factor IIH subunit 5

Homo sapiens

UniProt Q6ZYL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H5_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–71； UniProt 1–71

DNA repair protein complementing XP-C cells

Homo sapiens

UniProt A0A024R2M8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） UV excision repair protein RAD23 homolog B × 1 （P54727） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A024R2M8_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 11–950； UniProt 1–940

UV excision repair protein RAD23 homolog B

Homo sapiens

UniProt P54727

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） Centrin-2 × 1 （P41208） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RD23B_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–409； UniProt 1–409

Centrin-2

Homo sapiens

UniProt P41208

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 10 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 4, p52 × 1 （Q92759） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） DNA repair protein complementing XP-C cells × 1 （A0A024R2M8） UV excision repair protein RAD23 homolog B × 1 （P54727） DNA (ap) × 1 DNA × 1 IRON/SULFUR CLUSTER × 1 ZINC ION × 5 CALCIUM ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CETN2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–172； UniProt 1–172

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ebv
Deposition date deposition_date	2022-08-31
Structure title title	Initial DNA-lesion (AP) binding by XPC and TFIIH complex 1
Keywords keywords	protein-DNA complex, DNA BINDING PROTEIN-DNA complex; DNA BINDING PROTEIN/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ebv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ebv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ebv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	62.19 Å
Rg (electron density)	61.75 Å
Total Rg	61.81 Å
Atom count	30535
Residues	3630
Excluded volume	539320 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ebv__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	TFIIH basal transcription factor complex helicase XPB subunit
Molecular weight formula_weight	89404.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	30544

MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPD
Molecular weight formula_weight	88018.0 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQLDYKDDDDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	General transcription factor IIH subunit 1
Molecular weight formula_weight	62116.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQVLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	General transcription factor IIH subunit 4, p52
Molecular weight formula_weight	52245.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	General transcription factor IIH subunit 2
Molecular weight formula_weight	46926.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MGSSHHHHHHSSGLEVLFQGPHMDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	General transcription factor IIH subunit 3
Molecular weight formula_weight	34416.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 7 Entity 7 polymer

Description description	General transcription factor IIH subunit 5
Molecular weight formula_weight	8060.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 8 Entity 8 polymer

Description description	DNA repair protein complementing XP-C cells
Molecular weight formula_weight	107437.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDYKDDDDKHMARKRAAGGEPRGRELRSQKSKAKSKARREEEEEDAFEDEKPPKKSLLSKVSQGKRKRGCSHPGGSADGPAKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNEDSNEEEEESENDWEEVEELSEPVLGDVRESTAFSRSLLPVKPVEIEIETPEQAKTRERSEKIKLEFETYLRRAMKRFNKGVHEDTHKVHLLCLLANGFYRNNICSQPDLHAIGLSIIPARFTRVLPRDVDTYYLSNLVKWFIGTFTVNAELSASEQDNLQTTLERRFAIYSARDDEELVHIFLLILRALQLLTRLVLSLQPIPLKSATAKGKKPSKERLTADPGGSSETSSQVLENHTKPKTSKGTKQEETFAKGTCRPSAKGKRNKGGRKKRSKPSSSEEDEGPGDKQEKATQRRPHGRERRVASRVSYKEESGSDEAGSGSDFELSSGEASDPSDEDSEPGPPKQRKAPAPQRTKAGSKSASRTHRGSHRKDPSLPVASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEKL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 9 Entity 9 polymer

Description description	UV excision repair protein RAD23 homolog B
Molecular weight formula_weight	44275.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDEDLEHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	Centrin-2
Molecular weight formula_weight	19769.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	DNA (ap)
Molecular weight formula_weight	16171.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	L

AGGTAGTCACAGCTGATTGCGCTGAGGATNNTAGACGTGCGATATCTATGCCA

Entity 12 Entity 12 polymer

Description description	DNA
Molecular weight formula_weight	16219.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	M

TGGCATAGATATCGCACGTCTATTATCCTCAGCGCAATCAGCTGTGACTACCT

Entity 13 Entity 13 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 14 Entity 14 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 15 Entity 15 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	65301

Initial DNA-lesion (AP) binding by XPC and TFIIH complex 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

TFIIH basal transcription factor complex helicase XPB subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH helicase subunit XPD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 4, p52

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA repair protein complementing XP-C cells

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

UV excision repair protein RAD23 homolog B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centrin-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer