SAXSdb — 9hiz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunoglobulin heavy constant gamma 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	DNA-binding protein 7d × 4 （P13123）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IGHG1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 9–217； UniProt 119–327 Author chain B； PDBConstruct 9–217； UniProt 119–327 Author chain C； PDBConstruct 9–217； UniProt 119–327 Author chain D； PDBConstruct 9–217； UniProt 119–327

DNA-binding protein 7d

Sulfolobus acidocaldarius DSM 639

UniProt P13123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Immunoglobulin heavy constant gamma 1 × 4 （P01857）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DN7D_SULAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain R； PDBConstruct 5–69； UniProt 2–66 Author chain S； PDBConstruct 5–69； UniProt 2–66 Author chain T； PDBConstruct 5–69； UniProt 2–66 Author chain U； PDBConstruct 5–69； UniProt 2–66

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hiz
Deposition date deposition_date	2024-11-27
Last revision last_revision	2025-07-23
Structure title title	Complex of the Nanofitin Sac7d-C3(C24A) with a human IgG1 Fc fragment
Keywords keywords	NANOFITIN, FC FRAGMENT, IGG1, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hiz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hiz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hiz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.92 Å
Rg (electron density)	38.62 Å
Total Rg	38.95 Å
Atom count	8892
Residues	1112
Excluded volume	157930 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hiz__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Immunoglobulin heavy constant gamma 1
Molecular weight formula_weight	24781.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	8892

MKHHHHHHGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli B

Entity 2 Entity 2 polymer

Description description	DNA-binding protein 7d
Molecular weight formula_weight	7887.9 kDa
Mutation mutation	K7L,Y8L,K9N,K21R,K22D,W24A,V26Q,M29N,S31K,T33L,D35N,T40Y,R42A,A44N,S46D
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S,T,U

DAEFVKVKFLLNGEEKEVDTSKIRDVARQGKNVKFLYNDNGKYGAGNVDEKDAPKELLDMLARAEREKK

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Escherichia coli B

▶

Unit-cell length a length_a	68.270 Å
Unit-cell length b length_b	136.840 Å
Unit-cell length c length_c	69.760 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.12 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	69.760 Å
R factor r_factor	0.2299
R_work r_work	0.2273
R_free r_free	0.2793

Complex of the Nanofitin Sac7d-C3(C24A) with a human IgG1 Fc fragment

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunoglobulin heavy constant gamma 1

State in the Current Structure

Other States of the Same Protein in the Database

DNA-binding protein 7d

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hiz__assembly_1__model_1

9hiz__assembly_1__model_1 | I(q)

9hiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Complex of the Nanofitin Sac7d-C3(C24A) with a human IgG1 Fc fragment

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunoglobulin heavy constant gamma 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-binding protein 7d

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hiz__assembly_1__model_1

9hiz__assembly_1__model_1 | I(q)

9hiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)