SAXSdb — 1a1h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

QGSR ZINC FINGER PEPTIDE

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain A； UniProt 308–396	Not recorded	;DNA (5'-D(APGPCPGPTPGPGPGPCPAPC)-3') ; × 1 ;DNA (5'-D(TPGPTPGPCPCPCPAPCPGPC)-3') ; × 1 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 8.5；27.5-35% PEG 3350, 0-200 MM NACL, 100 MM TRIS PH 8.5, VAPOR DIFFUSION	Resolution 1.60 Å R-free 0.277

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1A1H	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A1F DSNR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GACC SITE) Deposited 1997-12-10	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 308–396（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；20% PEG 400, 200MM MGCL2, 100 MM HEPES PH 7.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.10 Å R-free 0.270
1A1G DSNR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GCGT SITE) Deposited 1997-12-10	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 308–396（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；25% PEG 1450, 200 MM NACL, 25 MM BIS-TRIS PROPANE PH 8.0, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.275
1A1I RADR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GCAC SITE) Deposited 1997-12-10	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 308–396（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；22.5% PEG 3350, 500MM NACL, 25 MM MES PH 6.2, VAPOR DIFFUSION, HANGING DROP	Resolution 1.60 Å R-free 0.216
1A1J RADR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GCGT SITE) Deposited 1997-12-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 308–396（89 aa） Fragment：ZINC FINGER	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；35% PEG 3350, 200MM NACL, 25 MM MES PH 6.2, VAPOR DIFFUSION, HANGING DROP	Resolution 2.00 Å R-free 0.262
1A1K RADR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GACC SITE) Deposited 1997-12-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 308–396（89 aa） Fragment：ZINC FINGER	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.2；25% PEG 1450, 25 MM MES PH 6.2	Resolution 1.90 Å R-free 0.259
1A1L ZIF268 ZINC FINGER-DNA COMPLEX (GCAC SITE) Deposited 1997-12-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 308–396（89 aa） Fragment：ZINC FINGER	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；35% PEG 1450, 300MM NACL, 25 MM BIS TRIS PROPANE PH 8.0, VAPOR DIFFUSION, HANGING DROP	Resolution 2.30 Å R-free 0.267
1AAY ZIF268 ZINC FINGER-DNA COMPLEX Deposited 1997-01-18	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 308–396（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；2.5-5% PEG 400; 500-700MM NACL; 25MM BIS-TRIS PROPANE, PH 8.0, VAPOR DIFFUSION, HANGING DROP	Resolution 1.60 Å R-free 0.242
1F2I COCRYSTAL STRUCTURE OF SELECTED ZINC FINGER DIMER BOUND TO DNA Deposited 2000-05-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain G 334–389（56 aa） Fragment：ZIF12 CONTAINS ZINC FINGERS 1 AND 2 OF ZIF268 Chain H 334–389（56 aa） Fragment：ZIF12 CONTAINS ZINC FINGERS 1 AND 2 OF ZIF268	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；298 K；PEG 4000, NaCl, MgCl2, MES, pH 6.2, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.35 Å R-free 0.256
1F2I COCRYSTAL STRUCTURE OF SELECTED ZINC FINGER DIMER BOUND TO DNA Deposited 2000-05-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain I 334–389（56 aa） Fragment：ZIF12 CONTAINS ZINC FINGERS 1 AND 2 OF ZIF268 Chain J 334–389（56 aa） Fragment：ZIF12 CONTAINS ZINC FINGERS 1 AND 2 OF ZIF268	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；298 K；PEG 4000, NaCl, MgCl2, MES, pH 6.2, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.35 Å R-free 0.256
1F2I COCRYSTAL STRUCTURE OF SELECTED ZINC FINGER DIMER BOUND TO DNA Deposited 2000-05-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain K 334–389（56 aa） Fragment：ZIF12 CONTAINS ZINC FINGERS 1 AND 2 OF ZIF268 Chain L 334–389（56 aa） Fragment：ZIF12 CONTAINS ZINC FINGERS 1 AND 2 OF ZIF268	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；298 K；PEG 4000, NaCl, MgCl2, MES, pH 6.2, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.35 Å R-free 0.256
1G2D STRUCTURE OF A CYS2HIS2 ZINC FINGER/TATA BOX COMPLEX (CLONE #2) Deposited 2000-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain C 333–421（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；PEG 400, NaCl, Bis-Tris Propane, CoCl2, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.262
1G2D STRUCTURE OF A CYS2HIS2 ZINC FINGER/TATA BOX COMPLEX (CLONE #2) Deposited 2000-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain F 333–421（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；PEG 400, NaCl, Bis-Tris Propane, CoCl2, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.262
1G2F STRUCTURE OF A CYS2HIS2 ZINC FINGER/TATA BOX COMPLEX (TATAZF;CLONE #6) Deposited 2000-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain C 333–421（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；PEG 400; NaCl; Bis-Tris Propane; CoCl2, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.263
1G2F STRUCTURE OF A CYS2HIS2 ZINC FINGER/TATA BOX COMPLEX (TATAZF;CLONE #6) Deposited 2000-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain F 333–421（89 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；PEG 400; NaCl; Bis-Tris Propane; CoCl2, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.263
1JK1 Zif268 D20A Mutant Bound to WT DNA Site Deposited 2001-07-11	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 333–421（89 aa） Fragment：ZINC FINGERS (Residues 333-421)	Mutation：D120A	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；300 mM NaCl, 10% PEG 1450, 25 mM Bis-Tris propane, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.266
1JK2 Zif268 D20A mutant bound to the GCT DNA site Deposited 2001-07-11	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 333–421（89 aa） Fragment：ZINC FINGERS (Residues 333-421)	Mutation：D120A	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；300 mM NaCl, 10% PEG 1450, 25 mM Bis-Tris propane, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.65 Å R-free 0.273
1LLM Crystal Structure of a Zif23-GCN4 Chimera Bound to DNA Deposited 2002-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 364–412（49 aa） Chain D 364–412（49 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；bis-tris propane, magnesium chloride, ammonium acetate, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.234
1P47 Crystal Structure of tandem Zif268 molecules complexed to DNA Deposited 2003-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 333–419（87 aa） Fragment：residues 333-419 Chain B 333–419（87 aa） Fragment：residues 333-419	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；bis-tris propane-HCl, sodium chloride, zinc cloride, ammonium acetate, PEG 400, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.267
1ZAA ZINC FINGER-DNA RECOGNITION: CRYSTAL STRUCTURE OF A ZIF268-DNA COMPLEX AT 2.1 ANGSTROMS Deposited 1992-09-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain C 332–418（87 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；pH 8.00, VAPOR DIFFUSION, HANGING DROP	Resolution 2.10 Å

15 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EGR1_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 2–90； UniProt 308–396

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1a1h
Deposition date deposition_date	1997-12-10
Structure title title	QGSR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GCAC SITE)
Keywords keywords	COMPLEX (ZINC FINGER-DNA), ZINC FINGER, DNA-BINDING PROTEIN, TRANSCRIPTION-DNA COMPLEX; TRANSCRIPTION/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	16.23 Å
Radius of gyration Rg (electron density) rg_electron	15.98 Å
Forward intensity I(0) i0	9223240.00
Molecular weight molecular_weight	16950.0 kDa
Excluded volume excluded_volume	18801 Å³
Envelope volume envelope_volume	23813 Å³
Hydration-shell volume shell_volume	13075 Å³
Envelope diameter envelope_diameter	60.5 Å
Shell Rg shell_rg	21.31 Å
Envelope Rg envelope_rg	16.44 Å
Shape Rg shape_rg	15.90 Å
Total Rg total_rg	16.88 Å
Total atoms total_atoms	1151
Residues n_residues	107
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	56.9 Å
Rg (real space) rg_real	16.22 Å
Rg uncertainty (real space) rg_real_error	0.40 Å
I(0) (real space) i0_real	9.2230e+06
I(0) uncertainty (real space) i0_real_error	1.1050e+05
Rg (reciprocal space) rg_reciprocal	16.22 Å
I(0) (reciprocal space) i0_reciprocal	9223000.0000
Solution quality estimate total_estimate	0.6553
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	20.4 Å
Skewness Skewness skewness	0.387
Kurtosis Kurtosis kurtosis	-0.045
Angular range angular_range	— – 0.4900 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1272000.0000
Real-space data points n_real_points	79
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.694; Stabil: 0.999; Sysdev: 0.485; Positv: 1.000; Valcen: 0.980; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	;DNA (5'-D(APGPCPGPTPGPGPGPCPAP*C)-3') ;
Molecular weight formula_weight	3399.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	B
Atom count atom_count	1311

AGCGTGGGCAC

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(TPGPTPGPCPCPCPAPCPGP*C)-3') ;
Molecular weight formula_weight	3310.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

TGTGCCCACGC

Entity 3 Entity 3 polymer

Description description	QGSR ZINC FINGER PEPTIDE
Molecular weight formula_weight	10724.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MERPYACPVESCDRRFSQSGSLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKD

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	149

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1a1ha1
Class class	g — Small proteins
Fold Fold fold	g.37 — beta-beta-alpha zinc fingers
Superfamily Superfamily superfamily	g.37.1 — beta-beta-alpha zinc fingers
Family Family family	g.37.1.1 — Classic zinc finger, C2H2

Domain ID domain_id	d1a1ha2
Class class	g — Small proteins
Fold Fold fold	g.37 — beta-beta-alpha zinc fingers
Superfamily Superfamily superfamily	g.37.1 — beta-beta-alpha zinc fingers
Family Family family	g.37.1.1 — Classic zinc finger, C2H2

Domain ID domain_id	d1a1ha3
Class class	g — Small proteins
Fold Fold fold	g.37 — beta-beta-alpha zinc fingers
Superfamily Superfamily superfamily	g.37.1 — beta-beta-alpha zinc fingers
Family Family family	g.37.1.1 — Classic zinc finger, C2H2

CATH v4.4 (3 domains)

Domain ID domain_id	1a1hA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	60 — Classic Zinc Finger

Domain ID domain_id	1a1hA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	60 — Classic Zinc Finger

Domain ID domain_id	1a1hA03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	60 — Classic Zinc Finger

▶

8. Citations (4)

▶

Unit-cell length a length_a	44.100 Å
Unit-cell length b length_b	55.900 Å
Unit-cell length c length_c	130.500 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	1.600 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2350
R_work r_work	0.2350
R_free r_free	0.2770

fit	/app/data/saxs_computation/a1/1a1h/1a1h.fit
pddf	/app/data/pr_computation/a1/1a1h/1a1h.pr.out
profile	/app/data/saxs_computation/a1/1a1h/1a1h.dat

QGSR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GCAC SITE)

1. Protein Identity and Related Structures Protein Identity & Related Structures

QGSR ZINC FINGER PEPTIDE

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

8. Citations (4)

9. Files and Curves (10)

Files (7)

Curves (3)