1gtf

The structure of the trp RNA-binding attenuation protein (TRAP) bound to a 53-nucleotide RNA molecule containing GAGUU repeats

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRP RNA-BINDING ATTENUATION PROTEIN (TRAP)

BACILLUS STEAROTHERMOPHILUS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 11	TRYPTOPHAN × 11 water × 11	Consistent with protein count
2	Protein–RNA	Homooligomer	Protein 11 RNA 1	(GAGUU)10GAG 53-NUCLEOTIDE RNA × 1 TRYPTOPHAN × 11 water × 12	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTRB_BACST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–74； UniProt 1–74 Author chain B； PDBConstruct 1–74； UniProt 1–74 Author chain C； PDBConstruct 1–74； UniProt 1–74 Author chain D； PDBConstruct 1–74； UniProt 1–74 Author chain E； PDBConstruct 1–74； UniProt 1–74 Author chain F； PDBConstruct 1–74； UniProt 1–74 Author chain G； PDBConstruct 1–74； UniProt 1–74 Author chain H； PDBConstruct 1–74； UniProt 1–74 Author chain I； PDBConstruct 1–74； UniProt 1–74 Author chain J； PDBConstruct 1–74； UniProt 1–74 Author chain K； PDBConstruct 1–74； UniProt 1–74 Author chain L； PDBConstruct 1–74； UniProt 1–74 Author chain M； PDBConstruct 1–74； UniProt 1–74 Author chain N； PDBConstruct 1–74； UniProt 1–74 Author chain O； PDBConstruct 1–74； UniProt 1–74 Author chain P； PDBConstruct 1–74； UniProt 1–74 Author chain Q； PDBConstruct 1–74； UniProt 1–74 Author chain R； PDBConstruct 1–74； UniProt 1–74 Author chain S； PDBConstruct 1–74； UniProt 1–74 Author chain T； PDBConstruct 1–74； UniProt 1–74 Author chain U； PDBConstruct 1–74； UniProt 1–74 Author chain V； PDBConstruct 1–74； UniProt 1–74

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1gtf
Deposition date deposition_date	2002-01-15
Structure title title	The structure of the trp RNA-binding attenuation protein (TRAP) bound to a 53-nucleotide RNA molecule containing GAGUU repeats
Keywords keywords	RNA BINDING PROTEIN-RNA COMPLEX, TRANSCRIPTION ATTENUATION, RNA-BINDING PROTEIN, TRP RNA; RNA BINDING PROTEIN/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1gtf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1gtf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1gtf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.93 Å
Rg (electron density)	29.81 Å
Total Rg	30.79 Å
Atom count	6037
Residues	756
Excluded volume	106930 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1gtf__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1gtf__assembly_2__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	TRP RNA-BINDING ATTENUATION PROTEIN (TRAP)
Molecular weight formula_weight	8257.4 kDa
Source method src_method	man
Copy count entity_count	22

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V
Atom count atom_count	14607

MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK

Source Source

Source organism organism	BACILLUS STEAROTHERMOPHILUS
NCBI taxonomy ID ncbi_taxonomy_id	1422
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	(GAGUU)10GAG 53-NUCLEOTIDE RNA
Molecular weight formula_weight	17906.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	W

GAGUUGAGUUGAGUUGAGUUGAGUUGAGUUGAGUUGAGUUGAGUUGAGUUGAGUU

Entity 3 Entity 3 non-polymer

Description description	TRYPTOPHAN
Molecular weight formula_weight	204.2 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1466

▼

6. Fold Classification (SCOP + CATH) 44 domains

SCOP 2.08 (22 domains)

Domain ID domain_id	d1gtfa_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfb_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfc_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfd_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfe_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtff_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfg_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfh_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfi_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfj_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfk_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfl_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfm_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfn_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfo_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfp_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfq_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfr_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfs_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtft_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfu_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1gtfv_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

CATH v4.4 (22 domains)

Domain ID domain_id	1gtfA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfG00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfH00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfI00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfJ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfK00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfL00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfM00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfN00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfO00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfP00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfQ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfR00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfT00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfU00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1gtfV00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

▶

Unit-cell length a length_a	142.077 Å
Unit-cell length b length_b	111.493 Å
Unit-cell length c length_c	138.232 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.28 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	88

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	47.670 Å
R factor r_factor	0.1940
R_work r_work	0.1940
R_free r_free	0.2420

The structure of the trp RNA-binding attenuation protein (TRAP) bound to a 53-nucleotide RNA molecule containing GAGUU repeats

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRP RNA-BINDING ATTENUATION PROTEIN (TRAP)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1gtf__assembly_1__model_1

1gtf__assembly_1__model_1 | I(q)

1gtf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 44 domains

SCOP 2.08 (22 domains)

CATH v4.4 (22 domains)

7. Citations (2)

The structure of the trp RNA-binding attenuation protein (TRAP) bound to a 53-nucleotide RNA molecule containing GAGUU repeats

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRP RNA-BINDING ATTENUATION PROTEIN (TRAP)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1gtf__assembly_1__model_1

1gtf__assembly_1__model_1 | I(q)

1gtf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 44 domains

SCOP 2.08 (22 domains)

CATH v4.4 (22 domains)

7. Citations (2)