SAXSdb — 4v4f

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRANSCRIPTION ATTENUATION PROTEIN MTRB

BACILLUS STEAROTHERMOPHILUS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Homooligomer	Protein 11 RNA 11	5'-R(UPAPGPAP*UP)-3' × 11 TRYPTOPHAN × 11 water × 22	Consistent with all polymers
2	Protein homooligomer	Homooligomer	Protein 11	TRYPTOPHAN × 11 water × 11	Consistent with protein count
3	Protein–RNA	Homooligomer	Protein 11 RNA 11	5'-R(UPAPGPAP*UP)-3' × 11 TRYPTOPHAN × 11 water × 22	Consistent with all polymers
4	Protein homooligomer	Homooligomer	Protein 11	TRYPTOPHAN × 11 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTRB_BACST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AA； PDBConstruct 1–74； UniProt 1–74 Author chain AB； PDBConstruct 1–74； UniProt 1–74 Author chain AC； PDBConstruct 1–74； UniProt 1–74 Author chain AD； PDBConstruct 1–74； UniProt 1–74 Author chain AE； PDBConstruct 1–74； UniProt 1–74 Author chain AF； PDBConstruct 1–74； UniProt 1–74 Author chain AG； PDBConstruct 1–74； UniProt 1–74 Author chain AH； PDBConstruct 1–74； UniProt 1–74 Author chain AI； PDBConstruct 1–74； UniProt 1–74 Author chain AJ； PDBConstruct 1–74； UniProt 1–74 Author chain AK； PDBConstruct 1–74； UniProt 1–74 Author chain AL； PDBConstruct 1–74； UniProt 1–74 Author chain AM； PDBConstruct 1–74； UniProt 1–74 Author chain AN； PDBConstruct 1–74； UniProt 1–74 Author chain AO； PDBConstruct 1–74； UniProt 1–74 Author chain AP； PDBConstruct 1–74； UniProt 1–74 Author chain AQ； PDBConstruct 1–74； UniProt 1–74 Author chain AR； PDBConstruct 1–74； UniProt 1–74 Author chain AS； PDBConstruct 1–74； UniProt 1–74 Author chain AT； PDBConstruct 1–74； UniProt 1–74 Author chain AU； PDBConstruct 1–74； UniProt 1–74 Author chain AV； PDBConstruct 1–74； UniProt 1–74 Author chain BA； PDBConstruct 1–74； UniProt 1–74 Author chain BB； PDBConstruct 1–74； UniProt 1–74 Author chain BC； PDBConstruct 1–74； UniProt 1–74 Author chain BD； PDBConstruct 1–74； UniProt 1–74 Author chain BE； PDBConstruct 1–74； UniProt 1–74 Author chain BF； PDBConstruct 1–74； UniProt 1–74 Author chain BG； PDBConstruct 1–74； UniProt 1–74 Author chain BH； PDBConstruct 1–74； UniProt 1–74 Author chain BI； PDBConstruct 1–74； UniProt 1–74 Author chain BJ； PDBConstruct 1–74； UniProt 1–74 Author chain BK； PDBConstruct 1–74； UniProt 1–74 Author chain BL； PDBConstruct 1–74； UniProt 1–74 Author chain BM； PDBConstruct 1–74； UniProt 1–74 Author chain BN； PDBConstruct 1–74； UniProt 1–74 Author chain BO； PDBConstruct 1–74； UniProt 1–74 Author chain BP； PDBConstruct 1–74； UniProt 1–74 Author chain BQ； PDBConstruct 1–74； UniProt 1–74 Author chain BR； PDBConstruct 1–74； UniProt 1–74 Author chain BS； PDBConstruct 1–74； UniProt 1–74 Author chain BT； PDBConstruct 1–74； UniProt 1–74 Author chain BU； PDBConstruct 1–74； UniProt 1–74 Author chain BV； PDBConstruct 1–74； UniProt 1–74

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v4f
Deposition date deposition_date	2003-12-08
Structure title title	The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats
Keywords keywords	RNA BINDING PROTEIN, TRANSCRIPTION ATTENUATION, RNA-BINDING PROTEIN, TRP RNA; RNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v4f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v4f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v4f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.29 Å
Rg (electron density)	30.59 Å
Total Rg	31.61 Å
Atom count	6729
Residues	806
Excluded volume	116480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v4f__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4v4f__assembly_2__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4v4f__assembly_3__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4v4f__assembly_4__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	5'-R(UPAPGPAP*UP)-3'
Molecular weight formula_weight	1571.0 kDa
Source method src_method	syn
Copy count entity_count	22

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A0,A1,A2,A3,A4,A5,A6,A7,A8,A9,AZ,B0,B1,B2,B3,B4,B5,B6,B7,B8,B9,BZ
Atom count atom_count	29038

UAGAU

Entity 2 Entity 2 polymer

Description description	TRANSCRIPTION ATTENUATION PROTEIN MTRB
Molecular weight formula_weight	8257.4 kDa
Source method src_method	man
Copy count entity_count	44

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,AP,AQ,AR,AS,AT,AU,AV,BA,BB,BC,BD,BE,BF,BG,BH,BI,BJ,BK,BL,BM,BN,BO,BP,BQ,BR,BS,BT,BU,BV

MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK

Source Source

Source organism organism	BACILLUS STEAROTHERMOPHILUS
NCBI taxonomy ID ncbi_taxonomy_id	1422
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	TRYPTOPHAN
Molecular weight formula_weight	204.2 kDa
Source method src_method	syn
Copy count entity_count	44

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3318

▶

Unit-cell length a length_a	113.907 Å
Unit-cell length b length_b	133.986 Å
Unit-cell length c length_c	232.826 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.11 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	176

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1860
R_work r_work	0.1860
R_free r_free	0.2360

The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRANSCRIPTION ATTENUATION PROTEIN MTRB

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v4f__assembly_1__model_1

4v4f__assembly_1__model_1 | I(q)

4v4f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (3)

The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRANSCRIPTION ATTENUATION PROTEIN MTRB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v4f__assembly_1__model_1

4v4f__assembly_1__model_1 | I(q)

4v4f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (3)