6tda

Structure of SWI/SNF chromatin remodeler RSC bound to a nucleosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3.2

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H32_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–135； UniProt 2–136 Author chain E； PDBConstruct 1–135； UniProt 2–136

Histone H4

Xenopus laevis

UniProt P62799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–102； UniProt 2–103 Author chain F； PDBConstruct 1–102； UniProt 2–103

Histone H2A

Xenopus laevis

UniProt Q6AZJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6AZJ8_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–129； UniProt 2–130 Author chain G； PDBConstruct 1–129； UniProt 2–130

Histone H2B 1.1

Xenopus laevis

UniProt P02281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B11_XENLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–122； UniProt 5–126 Author chain H； PDBConstruct 1–122； UniProt 5–126

Chromatin structure-remodeling complex subunit SFH1

OrganismNot specified

UniProt Q06168

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SFH1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain K； PDBConstruct 1–426； UniProt 1–426

Chromatin structure-remodeling complex protein RSC8

OrganismNot specified

UniProt P43609

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain L； PDBConstruct 1–557； UniProt 1–557 Author chain L； PDBConstruct 558–1114； UniProt 1–557

Chromatin structure-remodeling complex subunit RSC7

OrganismNot specified

UniProt P32832

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC7_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–435； UniProt 1–435

Chromatin structure-remodeling complex subunit RSC9

OrganismNot specified

UniProt Q03124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC9_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–581； UniProt 1–581

Chromatin structure-remodeling complex protein RSC6

OrganismNot specified

UniProt P25632

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC6_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–483； UniProt 1–483

Chromatin structure-remodeling complex protein RSC58

OrganismNot specified

UniProt Q07979

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC58_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–502； UniProt 1–502

High temperature lethal protein 1

OrganismNot specified

UniProt Q9URQ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HTL1_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–78； UniProt 1–78

Chromatin structure-remodeling complex subunit RSC4

OrganismNot specified

UniProt Q02206

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC4_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain R； PDBConstruct 1–625； UniProt 1–625

Nuclear protein STH1/NPS1

OrganismNot specified

UniProt P32597

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STH1_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain S； PDBConstruct 1–1359； UniProt 1–1359

Actin-related protein 7

OrganismNot specified

UniProt Q12406

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-like protein ARP9 × 1 （Q05123） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP7_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain T； PDBConstruct 2–477； UniProt 2–477

Actin-like protein ARP9

OrganismNot specified

UniProt Q05123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Regulator of Ty1 transposition protein 102 × 1 （P53330） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP9_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain U； PDBConstruct 2–467； UniProt 2–467

Regulator of Ty1 transposition protein 102

OrganismNot specified

UniProt P53330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA-I × 1 DNA-J × 1 Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC8 × 1 （P43609） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Nuclear protein STH1/NPS1 × 1 （P32597） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Unknown protein × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT102_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain V； PDBConstruct 2–157； UniProt 2–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6tda
Deposition date deposition_date	2019-11-08
Structure title title	Structure of SWI/SNF chromatin remodeler RSC bound to a nucleosome
Keywords keywords	Chromatin remodeler DNA binding Nucleosome binding ATPase Transcription, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6tda__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6tda__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6tda__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	73.24 Å
Rg (electron density)	72.81 Å
Total Rg	72.73 Å
Atom count	42548
Residues	5122
Excluded volume	732340 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6tda__assembly_1__model_1`	23-meric （23）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	Histone H3.2
Molecular weight formula_weight	15303.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	42577

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Histone H4
Molecular weight formula_weight	11263.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Histone H2A
Molecular weight formula_weight	13978.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Histone H2B 1.1
Molecular weight formula_weight	13524.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	DNA-I
Molecular weight formula_weight	72876.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	I

CCTACGGACCGGATATCTTCCCTGTGTATGGGTTTCCATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGATTTAACTCTTTTCGTCGGTTTTTTTCGCCTTTAAAACTAGGCGGGCTGGGTAATGA

Entity 6 Entity 6 polymer

Description description	DNA-J
Molecular weight formula_weight	73478.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	J

TCATTACCCAGCCCGCCTAGTTTTAAAGGCGAAAAAAACCGACGAAAAGAGTTAAATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGATGGAAACCCATACACAGGGAAGATATCCGGTCCGTAGG

Entity 7 Entity 7 polymer

Description description	Chromatin structure-remodeling complex subunit SFH1
Molecular weight formula_weight	48833.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSHQNQLIPQAYISNFHNRLTNEDDGIPIFTMAQQTRQHKRAKVVNYAEYDNDLFDEFNMNGSNFNNADTHYKDNAVSHENTPALTNGVTMDGSEYNVLENMNGADSIISNNKYDAGSNMVVESLSGLNSNNNASNGPSNKAQAQDIGNAVLPDLQDQHHNPFNILRYPKIRDTFINGKVVSPYRLNTDQETKANANSGEAIMIPITLDIEHMGHTIKDQFLWNYNDDSISPEEFASIYCKDLDMTSATLQTQIANIIKEQLKDLENIAATEIMSDLHVIINLTCNLQDRFFEDNFQWNLNDKSLTPERFATSIVQDLGLTREFIPLISQSLHETILKIKKDWVDGHLIQDHVPNDAAFGYLSGIRLDIDELGSNWCPRVEILTKEEIQKREIEKERNLRRLKRETDRLSRRGRRRLDDLETTMRM

Entity 8 Entity 8 polymer

Description description	Chromatin structure-remodeling complex protein RSC8
Molecular weight formula_weight	126489.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSDTEKDKDVPMVDSHEATEEPPTTSTNTPSFPHLAQEQAKEESATLGAEVAHKKINYEQEAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIGPSFTGHFQVVLDTPQGLKPFLPENVIKQEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQDFNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSDFIRLENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIEDNYIREVVGSTLNGKGGDSRDGSVSGSKLMECVNDAVQTLLQGDDKLGKVSDKSREISEKYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQILDLNKSLEELNVSKKLVLISEQVDSGIQLVEKDQEGDDEDGNTATGHGVKRVGKEGEEVGEGDSIAKLQPQVYKPWSLMSDTEKDKDVPMVDSHEATEEPPTTSTNTPSFPHLAQEQAKEESATLGAEVAHKKINYEQEAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIGPSFTGHFQVVLDTPQGLKPFLPENVIKQEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQDFNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSDFIRLENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIEDNYIREVVGSTLNGKGGDSRDGSVSGSKLMECVNDAVQTLLQGDDKLGKVSDKSREISEKYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQILDLNKSLEELNVSKKLVLISEQVDSGIQLVEKDQEGDDEDGNTATGHGVKRVGKEGEEVGEGDSIAKLQPQVYKPWSL

Entity 9 Entity 9 polymer

Description description	Chromatin structure-remodeling complex subunit RSC7
Molecular weight formula_weight	49716.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSDSEGGLASEVEHEKRSRSTSNRPNYAIDTEDLDIDENDENEDDDYREEEANEGVNEEEISDEEEQINKSGRNKRRHVDEEEDLSEDKGVTRSRNRSKFKKPVFPGIDDAEENLNPLKVVNEEYVLPDDPEGETKITADGDLLGGREFLVRTFTLTEKGNRKFMLATEPARIVGFRDSYLFFQTHPNLYKFILNQTQKNDLIDRGVLPYSYRNRQIALVTARGVFKEFGAKIIRGGKHITDDYYASELRTKGNVIEGKLAGDPIDKSARALETMMYPASENGINPAKNQVEFFEHRPHGHMSNSNIIASGSKLSSTNWLYQHSAACSRFNSDLFYDRVKVLLVDQQGLRDAYTNILHIPESTQSTTVLGWRRSKNDSPSDTSIVYETVIHDNDLNKPKTGLSEIPKEIYEDVVDEDVLRAITEQQNFEKCNEYI

Entity 10 Entity 10 polymer

Description description	Chromatin structure-remodeling complex subunit RSC9
Molecular weight formula_weight	65289.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNSLASNTPLNGTPVSEAPATSSEPVNMFETMVANPIKVSRLQSNGVLTGPAANTKSIHYSLANFNVFQSLPKETARGVDDLTRMEMALLSGIPEEIKWSLKKYLTYSNKAPYMISLRTLPDLLPLFKTFILPLERIVEGLNKSSICDSKAMDSLQMGLNALLILRNLAQDTDSVQILVKDREIKSFILFILKKFQCVATGDNKWQLYEGNATFFNELTHYTLDLMEAISSYIAPAMKDDHYFQTLVSILNYTKDRYMVISILRSLSRLLVRSKANEESAADNLDHKTLSLIVSFLLLECDSELIIASLDFLYQYILPGSQRITELFKSKECSLILEATLPNLLSYNIATPDYHLLQKHKIRLIKRLKPPAPKEPPNLSEDLFQQLFKLNEPLRSTAWLRCCFEPVQEAEFTQISLWRSYESKFGQPVRESGRKLLPAVEFIKNVSNAFNNAAAIVITDPVTGKKRFVIKGIQPRFKALGIADGERESQVPISALKSKFLNDSKEITPARQNSIPEVKFPQELSDVSKVACTFLCLLSNDTDDGAGSAFCQRIRPLVLHKLADIPPLTLALSEYMENTSGL

Entity 11 Entity 11 polymer

Description description	Chromatin structure-remodeling complex protein RSC6
Molecular weight formula_weight	54222.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MVTQTNPVPVTYPTDAYIPTYLPDDKVSNLADLKKLIEMDSRLDLYLTRRRLDTSINLPTNTKTKDHPPNKEMLRIYVYNTTESSPRSDSGTPADSGKTTWTLRIEGKLLHESANGKHPFSEFLEGVAVDFKRLKPLGMGKKRKRDSSLSLPLNLQQPEYNDQDSTMGDNDNGEDEDSAEAESREEIVDALEWNYDENNVVEFDGIDIKRQGKDNLRCSITIQLRGVDGGKVQYSPNLATLIGMQTGSVNDAVYSIYKYILINNLFVTEQTEAQDGSNDAEDSSNENNNKNGAGDDDGVEGSTPKDKPELGEVKLDSLLQKVLDTNAAHLPLMNVVQTVNKLVSPLPPIILDYTIDLSKDTTYGATTLDVDVSHILHQPQPQPNLQKEEETDAEDTAKLREITKLALQLNSSAQKYQFFHELSLHPRETLTHYLWSSKQNELVLQGDQYFNEDAARTSDIYSNNNNDRSLMGNISLLYSQGRL

Entity 12 Entity 12 polymer

Description description	Chromatin structure-remodeling complex protein RSC58
Molecular weight formula_weight	57871.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTESVGGNKLVDFLVNVQSILNAASVKCHVVDESFPAKFFEKNPDKIYESYCKFIKNRSNSEGLIRNEDKLVLTTINKRFENGEYEPIQGGFYKLYHDIKLVCTILIHFYPQGTRNYQLVDKFYKFSSELLLRECCRIGIALTQTNNIKSRSGKLLSGNEMDEYDDDDATELDKIISYDFIKISMNYTVPISQTYQIRTKDMDLFSSIISKSNLDKRPHELPNTNFKINNVLPQTDIENEAPRLGFVGANTSNIPDPTLPPTEMMTRFLHPNWYALPTTVWLKYGNYNSWAPSFNENGTVVDSTTRGLIWLERIGYMDLYEKNEKKVKQEELLNTNEEGINRKQNDENNKNVDGKSNGVQDDGGDNDNDATIASANSESTENKEQFIIKLQNLYNWTPSNYIGDDEIENFRNGTPDKLVSDSLLKLKRLRKERILNKVLKPTTEERELYFKVKRILKEVILAKKVSKVPINNVRAFPVLQTNYNGSIPVVRAQPGRKRKHKK

Entity 13 Entity 13 polymer

Description description	High temperature lethal protein 1
Molecular weight formula_weight	9192.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSQNNTISSMNPERAYNNVTLKNLTAFQLLSQRENICELLNLVESTERHNSIINPERQRMSLEEMKKMLDALKNERKK

Entity 14 Entity 14 polymer

Description description	Chromatin structure-remodeling complex subunit RSC4
Molecular weight formula_weight	72372.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MVVKKRKLATEAGGSDERPKYLPGKHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFDKFEFENYLAIGGGGPAAAGALAISALDNDIEPESNREDLIDQADYDFNHFEGLGNGYNRSLLTEDYLLNPNNFKKLIAKPETVQSEVKNERSTTSDIEKTNSLESEHLKIPKYNVIKSMQKEMQSLSEQHTMEYKPYKLIQQIYIFSSKNLYSQATKPLLGSRPSCNQNWVEYIFNGNELSQNENAFSFMLQPMQTFLTLQSHLTSSLKDTETLLTINKEPVKSRTSNVNSNLSQPQQQENDVIGNDTKQDIENLTIGGGNNNDIVGNDNDKRNNITEIFDIRLSEGLNHLMFRCEDKISHETEFMNFWINVLP

Entity 15 Entity 15 polymer

Description description	Nuclear protein STH1/NPS1
Molecular weight formula_weight	156982.4 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MLQEQSELMSTVMNNTPTTVAALAAVAAASETNGKLGSEEQPEITIPKPRSSAQLEQLLYRYRAIQNHPKENKLEIKAIEDTFRNISRDQDIYETKLDTLRKSIDKGFQYDEDLLNKHLVALQLLEKDTDVPDYFLDLPDTKNDNTTAIEVDYSEKKPIKISADFNAKAKSLGLESKFSNATKTALGDPDTEIRISARISNRINELERLPANLGTYSLDDCLEFITKDDLSSRMDTFKIKALVELKSLKLLTKQKSIRQKLINNVASQAHHNIPYLRDSPFTAAAQRSVQIRSKVIVPQTVRLAEELERQQLLEKRKKERNLHLQKINSIIDFIKERQSEQWSRQERCFQFGRLGASLHNQMEKDEQKRIERTAKQRLAALKSNDEEAYLKLLDQTKDTRITQLLRQTNSFLDSLSEAVRAQQNEAKILHGEEVQPITDEEREKTDYYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESETNRDDDDKAELDDDELNDTLARSADEKILFDKIDKERMNQERADAKAQGLRVPPPRLIQLDELPKVFREDIEEHFKKEDSEPLGRIRQKKRVYYDDGLTEEQFLEAVEDDNMSLEDAIKKRREARERRRLRQNGTKENEIETLENTPEASETSLIENNSFTAAVDEETNADKETTASRSKRRSSRKKRTISIVTAEDKENTQEESTSQENGGAKVEEEVKSSSVEIINGSESKKKKPKLTVKIKLNKTTVLENNDGKRAEEKPESKSPAKKTAAKKTKTKSKSLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFTDEWFKEHSS

Entity 16 Entity 16 polymer

Description description	Actin-related protein 7
Molecular weight formula_weight	54613.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MTLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMADEQKRSTDVWYEASTWIQQFKSTMLQVSEKDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRDRKQSQATNATN

Entity 17 Entity 17 polymer

Description description	Actin-like protein ARP9
Molecular weight formula_weight	53366.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAPFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENEDEDEGTLNVAEIITSGRDTREVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNIDDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSVLPAATKKKSKFMTNSTAFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF

Entity 18 Entity 18 polymer

Description description	Regulator of Ty1 transposition protein 102
Molecular weight formula_weight	18005.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MDPQTLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRYKTWLRNQEDEKNLQRESCEDILDLKEFDRRILKKSLMTSHTKGDTSKATGAPSANQGDEALSVDDIRGAVGNSEAIPGLSAGVNNDNTKESKDVKMN

Entity 19 Entity 19 polymer

Description description	Unknown protein
Molecular weight formula_weight	32613.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 20 Entity 20 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	15.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	372442

Structure of SWI/SNF chromatin remodeler RSC bound to a nucleosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3.2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B 1.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit SFH1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit RSC7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit RSC9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC58

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer