SAXSdb — 6zik

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit gamma, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	ATP synthase subunit delta, mitochondrial × 1 （P05630） ATP synthase subunit epsilon, mitochondrial × 1 （P05632） ATP synthase F(0) complex subunit C2, mitochondrial × 8 （P07926）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain G； PDBConstruct 1–273； UniProt 26–298

ATP synthase subunit delta, mitochondrial

OrganismNot specified

UniProt P05630

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	ATP synthase subunit gamma, mitochondrial × 1 （P05631） ATP synthase subunit epsilon, mitochondrial × 1 （P05632） ATP synthase F(0) complex subunit C2, mitochondrial × 8 （P07926）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPD_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 23–168

ATP synthase subunit epsilon, mitochondrial

OrganismNot specified

UniProt P05632

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	ATP synthase subunit gamma, mitochondrial × 1 （P05631） ATP synthase subunit delta, mitochondrial × 1 （P05630） ATP synthase F(0) complex subunit C2, mitochondrial × 8 （P07926）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5E_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–50； UniProt 2–51

ATP synthase F(0) complex subunit C2, mitochondrial

OrganismNot specified

UniProt P07926

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	ATP synthase subunit gamma, mitochondrial × 1 （P05631） ATP synthase subunit delta, mitochondrial × 1 （P05630） ATP synthase subunit epsilon, mitochondrial × 1 （P05632）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AT5G2_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–75； UniProt 69–143 Author chain L； PDBConstruct 1–75； UniProt 69–143 Author chain M； PDBConstruct 1–75； UniProt 69–143 Author chain N； PDBConstruct 1–75； UniProt 69–143 Author chain O； PDBConstruct 1–75； UniProt 69–143 Author chain P； PDBConstruct 1–75； UniProt 69–143 Author chain Q； PDBConstruct 1–75； UniProt 69–143 Author chain R； PDBConstruct 1–75； UniProt 69–143

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6zik
Deposition date deposition_date	2020-06-26
Structure title title	bovine ATP synthase rotor domain, state 3
Keywords keywords	ATP synthase, mitochondria, mammalian, complex, SYNTHASE, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6zik__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6zik__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6zik__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.60 Å
Rg (electron density)	38.93 Å
Total Rg	39.28 Å
Atom count	7735
Residues	1040
Excluded volume	140730 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6zik__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit gamma, mitochondrial
Molecular weight formula_weight	30300.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G
Atom count atom_count	7735

ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEKADIKTPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKSEAANLAAAGKEVKIIGVGDKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALELLNSGYEFDEGSIIFNRFRSVISYKTEEKPIFSLDTISSAESMSIYDDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit delta, mitochondrial
Molecular weight formula_weight	15074.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AEAAAAQAPAAGPGQMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKALE

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit epsilon, mitochondrial
Molecular weight formula_weight	5662.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

VAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAMKTSGSTIKIVKVKKE

Entity 4 Entity 4 polymer

Description description	ATP synthase F(0) complex subunit C2, mitochondrial
Molecular weight formula_weight	7653.0 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,P,Q,R,O

DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	6zikQ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.66 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	61485

bovine ATP synthase rotor domain, state 3

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit gamma, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit delta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit epsilon, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase F(0) complex subunit C2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6zik__assembly_1__model_1

6zik__assembly_1__model_1 | I(q)

6zik__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

bovine ATP synthase rotor domain, state 3

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit gamma, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit delta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit epsilon, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit C2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6zik__assembly_1__model_1

6zik__assembly_1__model_1 | I(q)

6zik__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)