7egp

The structure of SWI/SNF-nucleosome complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SWI/SNF chromatin-remodeling complex subunit SWI1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SWI1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–1064； UniProt 251–1314

SWI/SNF chromatin-remodeling complex subunit SNF5

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P18480

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNF5_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–905； UniProt 1–905

SWI/SNF complex subunit SWI3

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32591

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SWI3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–825； UniProt 1–825 Author chain E； PDBConstruct 1–825； UniProt 1–825

Transcription regulatory protein SNF12

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P53628

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNF12_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–566； UniProt 1–566

Transcription regulatory protein SNF6

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P18888

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNF6_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–332； UniProt 1–332

SWI/SNF global transcription activator complex subunit SWP82

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P43554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SWP82_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–623； UniProt 1–623

Transcription regulatory protein SNF2

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P22082

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNF2_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–971； UniProt 430–1400

Regulator of Ty1 transposition protein 102

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P53330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT102_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain L； PDBConstruct 1–157； UniProt 1–157

Actin-related protein 7

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q12406

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP7_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–477； UniProt 1–477

Actin-like protein ARP9

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q05123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP9_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–467； UniProt 1–467

Histone H3.2

Xenopus laevis

UniProt P84233

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H32_XENLA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–135； UniProt 2–136 Author chain S； PDBConstruct 1–135； UniProt 2–136

Histone H4

Xenopus laevis

UniProt P62799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H2A × 2 （Q6AZJ8） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_XENLA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–102； UniProt 2–103 Author chain T； PDBConstruct 1–102； UniProt 2–103

Histone H2A

Xenopus laevis

UniProt Q6AZJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2B 1.1 × 2 （P02281） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6AZJ8_XENLA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–129； UniProt 2–130 Author chain U； PDBConstruct 1–129； UniProt 2–130

Histone H2B 1.1

Xenopus laevis

UniProt P02281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	SWI/SNF chromatin-remodeling complex subunit SWI1 × 1 （P09547） SWI/SNF chromatin-remodeling complex subunit SNF5 × 1 （P18480） SWI/SNF complex subunit SWI3 × 2 （P32591） Transcription regulatory protein SNF12 × 1 （P53628） Transcription regulatory protein SNF6 × 1 （P18888） SWI/SNF global transcription activator complex subunit SWP82 × 1 （P43554） Transcription regulatory protein SNF2 × 1 （P22082） Regulator of Ty1 transposition protein 102 × 1 （P53330） Actin-related protein 7 × 1 （Q12406） Actin-like protein ARP9 × 1 （Q05123） Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A × 2 （Q6AZJ8） DNA (239-MER) × 1 DNA (239-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 1 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B11_XENLA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain R； PDBConstruct 1–122； UniProt 5–126 Author chain V； PDBConstruct 1–122； UniProt 5–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7egp
Deposition date deposition_date	2021-03-24
Structure title title	The structure of SWI/SNF-nucleosome complex
Keywords keywords	Chromatin remodeler complex, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7egp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7egp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7egp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.14 Å
Rg (electron density)	69.29 Å
Total Rg	69.41 Å
Atom count	44844
Residues	5016
Excluded volume	779910 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7egp__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	SWI/SNF chromatin-remodeling complex subunit SWI1
Molecular weight formula_weight	124885.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	44871

SNQLISNYAASNSMDRSSSASNEFVPNTSDNNNNSNNHNMRNNSNNKTSNNNNVTAVPAATPANTNNSTSNANTVFSERAAMFAALQQKQQQRFQALQQQQQQQQNQQQQNQQPQQQQQQQQNPKFLQSQRQQQQRSILQSLNPALQEKISTELNNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRIFLQQFLQELLKKVQQQQQAAALANANNNINSASSAPTPAAPGASVPATAAPGTEAGIVPVSANTPKSLNSNININVNNNNIGQQQVKKPRKQRVKKKTKKELELERKEREDFQKRQQKLLEDQQRQQKLLLETKLRQQYEIELKKLPKVYKRSIVRNYKPLINRLKHYNGYDINYISKIGEKIDSNKPIFLFAPELGAINLHALSMSLQSKNLGEINTALNTLLVTSADSNLKISLVKYPELLDSLAILGMNLLSNLSQNVVPYHRNTSDYYYEDAGSNQYYVTQHDKMVDKIFEKVNNNATLTPNDSNDEKVTILVDSLTGNQLPTPTPTEMEPDLDTECFISMQSTSPAVKQWDLLPEPIRFLPNQFPLKIHRTPYLTSLKKIKDEIDDPFTKINTRGAEDPKVLINDQLSTISMILRNISFSDNNSRIMSRNFYLKRFISDLLWLVLIHPENFTCNRKILNFKKDLVIVLSNISHLLEIASSIDCLLILILVISFGQPKLNPMASSSSFGSESLTFNEFQLQWGKYQTFGVDILAKLFSLEKPNLNYFKSILLNKNTGNNLYDRNSNNNHKDKKLLRRLLNLYNDNNKNNNNRHNLLNDVVSFLFSAIPLQQVLSQSADPSLLIDQFSPVISQSLTSILVIVQKILPLSNEVFEISENNSDSNSNNNGNKDSSFNFNKNLPFVWLSSEENIGSGLLKLSEIILNINNSTSKNTLLQQQNYSKVLLPSINISCVQLIKCLVEKSICFENCLNNDPEILKKIASIPNLFPTDLEIFQLFTNPSVDIQIINQYQLLYNLKNDILTNLEGGSGGWSHPQFEKWSHPQFEKWSHPQFEK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 2 Entity 2 polymer

Description description	SWI/SNF chromatin-remodeling complex subunit SNF5
Molecular weight formula_weight	103954.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MNNQPQGTNSVPNSIGNIFSNIGTPSFNMAQIPQQLYQSLTPQQLQMIQQRHQQLLRSRLQQQQQQQQQTSPPPQTHQSPPPPPQQSQPIANQSATSTPPPPPAPHNLHPQIGQVPLAPAPINLPPQIAQLPLATQQQVLNKLRQQAIAKNNPQVVNAITVAQQQVQRQIEQQKGQQTAQTQLEQQRQLLVQQQQQQQLRNQIQRQQQQQFRHHVQIQQQQQKQQQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQGQIPQSQQVPQVRSMSGQPPTNVQPTIGQLPQLPKLNLPKYQTIQYDPPETKLPYPTYWSDKKADTDTLLYEQIIQRDKINKYSLIRETNGYDPFSIYGFSNKEYISRLWHTLKYYQDLKNTRMKSITSTSQKIPSASIWGNGYSGYGNGITNTTTRVIPQVEVGNRKHYLEDKLKVYKQAMNETSEQLVPIRLEFDQDRDRFFLRDTLLWNKNDKLIKIEDFVDDMLRDYRFEDATREQHIDTICQSIQEQIQEFQGNPYIELNQDRLGGDDLRIRIKLDIVVGQNQLIDQFEWDISNSDNCPEEFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSAIEDDDIRSRMLPTITLDDVYRPAAESKIFTPNLLQISAAELERLDKDKDRDTRRKRRQGRSNRRGMLALSGTSASNTSMNGVHNTVAAGNASSLPPGEILLPDIADIPRTFRTPVPSTLMPGGVDVGPSVESYELRNTTTYKSRPDRPKPVSPPCYIIDHIPGHSLLLSIKLPGKVNTKEEFAAAPNDTSSGTNAMLPSPESLKTKLNSNIRAGVTIPSIPNPIANHTVTNSPNPTLQPVIPGGAASKSVPTPSLPIAPPVAPHDSEATLLTNSNNGSSNNNTQNTGGSGGDYKDDDDK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 3 Entity 3 polymer

Description description	SWI/SNF complex subunit SWI3
Molecular weight formula_weight	94178.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

MENTLGEGSTVNASVDVDQHGNDNNSDSNANAAVAGVANTDTAGEESQQQDESLKDEATVPNTRDAESEAITVTAKQQPTMQANKLDSQETPSTEESRAQNVFGQDNEDSDNLFGETESSVSNNEANTPSIPTNPVDNENNKPAIKEDSTIQDSNGDVKNMEDVKIQKEEEPENNTVIEGVKEESQPDENTKEMDEVEEDDEDDDQPMISPDNSIFGDTKSESKQLGNTSSVANTPSEIPDAHKAEQEDIIEKTESVDKKVDSGEERNEQEREIMNDHSKSANPKKTTITRVEPETFEIPQAHEIVIPSYSKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQVDSKLLPKNIEPPLTSQYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMNTSDSESTLYKYLKESKRKYDEITHPPSTTDDENGDKNDNGGKMNNEVSTSTSMTGDANLLEEGETSRPLKKVKILEQIDENWSKEDLQKLLKGIQEFGADWYKVAKNVGNKSPEQCILRFLQLPIEDKFLYGDGNGKGDNDNGLGPLKYAPHLPFSKSENPVLSTIAFLVGLVNPKTVQSMTQRAIQSAESIKSQKEEISDQKPIEHIKEGSEIAISSLGYRSHIFATNEERQMNFLTNELIRLQMEKLDAKLNHLKKLEKFMELERKTLERQQENLLIQRLNFNQNSSKIVNVLSKCLNLISDSNINNSSVAEKEEIRSQIDHFKSMLSKPETLSIGKNPFNKPNIETGENHNGQSISNENDVKPISIEAPQFYRYWSAGGSGGHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 4 Entity 4 polymer

Description description	Transcription regulatory protein SNF12
Molecular weight formula_weight	63947.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSKVMKPSNGKGSRKSSKAATPDTKNFFHAKKKDPVNQDKANNASQITPTVPHSHPSDMVIPDHLAELIPELYSFQQLVDSEKRLDHFIHLRNLHMKRMVAQWERSKLSQEFLYPHLNFPNVKFLRIFISNVSENQPWQMDTNNEADLMALENATWTMRIEGRLLDNVQANDPAREKFSSFIESIVVDFKNKENDNVPSTKFNAAPEENATEGPSDKKLNLNLPLQFSLPNGDNSTTTNTDQNNATMGEETAKKDMSSTTPKLESVKWQYDPNNPVDFDGLDIKRVGSENVECTISILRKSSPEEPFMSYSPQLTAIIGLKSGTSHDAIFSIYKYIHLNELLTNDESAFENLMGNRNNHNSNTSTSKMLDAASSQVSIVKLDTQLITLLPSSLKESSPDTMKLTDLLSLINSTHLLPLQPIEIDYTVRVDKASTYGELVLDIEVPDVNALKFNNTQRESQIGAAELNENARELEQIKPKIALQDKEITSVLSNLHESNKRYRFFKKISEDPVKALNECIASTSNALKVLSGDEGYNEDMVRRANFYKENEAMLRENIEVILSNGRM

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 5 Entity 5 polymer

Description description	Transcription regulatory protein SNF6
Molecular weight formula_weight	37652.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MGVIKKKRSHHGKASRQQYYSGVQVGGVGSMGAINNNIPSLTSFAEENNYQYGYSGSSAGMNGRSLTYAQQQLNKQRQDFERVRLRPEQLSNIIHDESDTISFRSNLLKNFISSNDAFNMLSLTTVPCDRIEKSRLFSEKTIRYLMQKQHEMKTQAAELQEKPLTPLKYTKLIAAAEDGSRSTKDMIDAVFEQDSHLRYQPDGVVVHRDDPALVGKLRGDLREAPADYWTHAYRDVLAQYHEAKERIRQKEVTAGEAQDEASLQQQQQQDLQQQQQVVTTVASQSPHATATEKEPVPAVVDDPLENMFGDYSNEPFNTNFDDEFGDLDAVFF

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 6 Entity 6 polymer

Description description	SWI/SNF global transcription activator complex subunit SWP82
Molecular weight formula_weight	71510.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLGEDEGNTVLEKGNNPSVKQGEVGAVFIVPKILIREHERVILKQILQILDQDELVQPPLDKFPYKKLELPKYIDELKTRDATNTSYKMIQLDAYGEKKVGSNGELFGGRHYLFNTFTFTAHMGVLLVLLQDVIKVLYQSNATHDEDEFIVQHDQILVMETSEEQTKFLAKNGVIPEESKGSFKYITARSAFVEFGASVIAGGQRIVDDYWESLAKKQNLSSHQRVFKLSTNLISKISLLRPSFQNNRISNANEISANTNNTCTISTSKFESQYPIVTEQPSAEIREAYIENFAKGEHISAIVPGQSISGTLELSAQFRVPRYHSKNSFQQALQMKAMDIPIGRHEELLAQYESQAPDGSASISLPNHIPSVNPSNKPIKRMLSSILDINVSSSKNKKSEENEMIKPMNKGQHKNNTSLNINGWKFESLPLKSAENSGKQQYYRGLPLYEKNTLLERLKQLTPNEIKELEHLHDAVFVNTGLQNVRKVRTKKWKKYWQYKAGIPIGLKRSQLDEFKNKYLKDVLAQTSVTTNFNEITNTDETITTKRVPNPNFLGNCNIKDFKPPYIYSHVNKVPQNVAGDKTAVKLDTEVKNTNANPVVATDPVAAKPDNLANFSNEVAMNNGGSGGHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 7 Entity 7 polymer

Description description	Transcription regulatory protein SNF2
Molecular weight formula_weight	114311.9 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

LQDQYKEGIKVVDIDDPDMMVDSFTMPNISHSNIDYQTLLANSDHAKFTIEPGVLPVGIDTHTATDIYQTLIALNLDTTVNDCLDKLLNDECTESTRENALYDYYALQLLPLQKAVRGHVLQFEWHQNSLLTNTHPNFLSKIRNINVQDALLTNQLYKNHELLKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQALKANDEEAYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYYNVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQARKQRTKKEDKSEAIDGGGSGGHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 8 Entity 8 polymer

Description description	Regulator of Ty1 transposition protein 102
Molecular weight formula_weight	17817.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDPQTLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRYKTWLRNQEDEKNLQRESCEDILDLKEFDRRILKKSLMTSHTKGDTSKATGAPSANQGDEALSVDDIRGAVGNSEAIPGLSAGVNNDNTKESKDVKMN

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 9 Entity 9 polymer

Description description	Actin-related protein 7
Molecular weight formula_weight	53863.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MTLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMADEQKRSTDVWYEASTWIQQFKSTMLQVSEKDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRDRKQSQATNATN

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 10 Entity 10 polymer

Description description	Actin-like protein ARP9
Molecular weight formula_weight	53131.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MAPFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENEDEDEGTLNVAEIITSGRDTREVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNIDDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSVLPAATKKKSKFMTNSTAFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 11 Entity 11 polymer

Description description	Histone H3.2
Molecular weight formula_weight	15289.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,S

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 12 Entity 12 polymer

Description description	Histone H4
Molecular weight formula_weight	11263.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,T

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 13 Entity 13 polymer

Description description	Histone H2A
Molecular weight formula_weight	13978.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,U

SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 14 Entity 14 polymer

Description description	Histone H2B 1.1
Molecular weight formula_weight	13524.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,V

AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 15 Entity 15 polymer

Description description	DNA (239-MER)
Molecular weight formula_weight	72380.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	W

TTATGTGATGGACCCTATACGCGGCCGCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGAAGCTTGTCGAGAAGTACTAGAGGATCATAATCAGCCATACCACATTTGTAGAGGTTTTA

Entity 16 Entity 16 polymer

Description description	DNA (239-MER)
Molecular weight formula_weight	72740.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

TAAAACCTCTACAAATGTGGTATGGCTGATTATGATCCTCTAGTACTTCTCGACAAGCTTCAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGGCGGCCGCGTATAGGGTCCATCACATAA

Entity 17 Entity 17 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	BERYLLIUM TRIFLUORIDE ION
Molecular weight formula_weight	66.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	229461

The structure of SWI/SNF-nucleosome complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

SWI/SNF chromatin-remodeling complex subunit SWI1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI/SNF chromatin-remodeling complex subunit SNF5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI/SNF complex subunit SWI3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription regulatory protein SNF12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription regulatory protein SNF6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI/SNF global transcription activator complex subunit SWP82

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription regulatory protein SNF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Regulator of Ty1 transposition protein 102

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-like protein ARP9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer