8cty

12-mer DNA structure of ExBIM bound to RNase-H

Method: X-RAY DIFFRACTION D_max: 153.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonuclease H

Halalkalibacterium halodurans

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Homooligomer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain A； UniProt 59–196 Chain F； UniProt 59–196	Mutation：D132N	;DNA (5'-D(CPGPCPGPAPAPTPTP(OWR)PGPCPG)-3') ; × 2 EDO 1,2-ETHANEDIOL × 2 GOL GLYCEROL × 1 NA SODIUM ION × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；291 K；0.1 M HEPES sodium pH = 7.5, 10% v/v 2-propanol and 20% w/v PEG 4000	Resolution 2.30 Å R-free 0.261
2	Protein–DNA Homooligomer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain B； UniProt 59–196 Chain C； UniProt 59–196 Chain G； UniProt 59–196	Mutation：D132N	;DNA (5'-D(CPGPCPGPAPAPTPTP(OWR)PGPCPG)-3') ; × 2 EDO 1,2-ETHANEDIOL × 5 CL CHLORIDE ION × 1 GOL GLYCEROL × 3 PEG DI(HYDROXYETHYL)ETHER × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；291 K；0.1 M HEPES sodium pH = 7.5, 10% v/v 2-propanol and 20% w/v PEG 4000	Resolution 2.30 Å R-free 0.261
3	Protein–DNA Homooligomer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain D； UniProt 59–196 Chain E； UniProt 59–196 Chain H； UniProt 59–196	Mutation：D132N	;DNA (5'-D(CPGPCPGPAPAPTPTP(OWR)PGPCPG)-3') ; × 2 EDO 1,2-ETHANEDIOL × 2 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；291 K；0.1 M HEPES sodium pH = 7.5, 10% v/v 2-propanol and 20% w/v PEG 4000	Resolution 2.30 Å R-free 0.261

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8CTY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1ZBF Crystal structure of B. halodurans RNase H catalytic domain mutant D132N Deposited 2005-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 59–196（138 aa） Fragment：catalytic domain (residues 59-196)	Mutation：D132N	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；277 K；PEG 2000 monomethyl ether, ammonium sulfate, sodium acetate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.50 Å R-free 0.214
1ZBI Bacillus halodurans RNase H catalytic domain mutant D132N in complex with 12-mer RNA/DNA hybrid Deposited 2005-04-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：catalytic domain (residues 59-196) Chain B 59–196（138 aa） Fragment：catalytic domain (residues 59-196)	Mutation：D132N Mutation：D132N	MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；294 K；MPD, NaCl, HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 294K	Resolution 1.85 Å R-free 0.248
2G8F B. halodurans RNase H catalytic domain E188A mutant in complex with Mg2+ and RNA/DNA hybrid (non-P nick at the active site) Deposited 2006-03-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Bh-RNase HC	Mutation：E188A	MG MAGNESIUM ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；30% MPD, 0.1M citrate pH 5.6, 0.25M ammonium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.65 Å
2G8H B. halodurans RNase H catalytic domain D192N mutant in complex with Mg2+ and RNA/DNA hybrid (non-P nick at the active site) Deposited 2006-03-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Bh-RNase HC	Mutation：D192N	MG MAGNESIUM ION × 2 VO4 VANADATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；278 K；32% MPD, 0.1M Tris pH 7.0, 0.2 M NaCl, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 1.85 Å R-free 0.254
2G8I B. halodurans RNase H catalytic domain D192N mutant in complex with Mn2+ and RNA/DNA hybrid (non-P nick at the active site) Deposited 2006-03-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Bh-RNase HC	Mutation：D192N	MN MANGANESE (II) ION × 4 CL CHLORIDE ION × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；278 K；35% MPD, 0.1M Tris pH 7.0, 0.2 M NaCl, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 1.65 Å R-free 0.202
2G8K B. halodurans RNase H catalytic domain D192N mutant in complex with Ca2+ and RNA/DNA hybrid (non-P nick at the active site) Deposited 2006-03-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Bh-RNase HC	Mutation：D192N	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；278 K；27% MPD, 0.25M ammonium acetate, Na Citrate pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 1.65 Å R-free 0.210
2G8U B. halodurans RNase H catalytic domain D132N mutant in complex with Mg2+ and RNA/DNA hybrid (non-P nick at the active site) Deposited 2006-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Bh-RNase HC	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；278 K；25% MPD, 0.2M NaCl, 0.1M HEPES pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.70 Å R-free 0.288
2G8V B. halodurans RNase H catalytic domain E188A mutant in complex with Mg2+ and RNA/DNA hybrid (reaction product) Deposited 2006-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Bh-RNase HC	Mutation：E188A	MG MAGNESIUM ION × 2 EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；278 K；20% EtOH, 0.1 M Tris pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 1.85 Å R-free 0.240
2G8W B. halodurans RNase H catalytic domain E188A mutant in complex with Ca2+ and RNA/DNA hybrid Deposited 2006-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Bh-RNase HC	Mutation：E188A	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；278 K；12% isopropanol, 0.1M MES 6.0, 0.3M CaAc2, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.05 Å R-free 0.242
2R7Y Selenium Derivatized RNA/DNA Hybrid in complex with RNase H CATALYTIC DOMAIN MUTANT D132N Deposited 2007-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 62–193（132 aa）	Mutation：D132N	PO4 PHOSPHATE ION × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M MES, 12% PEG 20000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.231
3D0P Insights into RNA/DNA hybrid recognition and processing by RNase H from the crystal structure of a non-specific enzyme-dsDNA complex Deposited 2008-05-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 61–194（134 aa）	Mutation：D132N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M sodium acetate, 8 % (w/v) PEG 4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.80 Å R-free 0.241
3D0P Insights into RNA/DNA hybrid recognition and processing by RNase H from the crystal structure of a non-specific enzyme-dsDNA complex Deposited 2008-05-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 61–194（134 aa）	Mutation：D132N	NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M sodium acetate, 8 % (w/v) PEG 4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.80 Å R-free 0.241
3EY1 A Conformational Transition in the Structure of a 2'-Thiomethyl-Modified DNA Visualized at High Resolution Deposited 2008-10-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：RNase H domain, UNP residues 59-196	Mutation：D132N	GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M Sodium Acetate (pH 4.6), 0.2 M ammonium sulphate, 25% PEG 4000., VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.60 Å R-free 0.261
3I8D The Pairing Geometry of the Hydrophobic Thymine Analog 2,4-Difluorotoluene in Duplex DNA as Analyzed by X-ray Crystallography Deposited 2009-07-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 62–193（132 aa） Fragment：RNase-H	Mutation：D132N	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M NaOAc 3H2O (pH 4.6) and 8% (w/v) PEG 4000 , VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.61 Å R-free 0.238
3I8D The Pairing Geometry of the Hydrophobic Thymine Analog 2,4-Difluorotoluene in Duplex DNA as Analyzed by X-ray Crystallography Deposited 2009-07-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 62–193（132 aa） Fragment：RNase-H	Mutation：D132N	GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M NaOAc 3H2O (pH 4.6) and 8% (w/v) PEG 4000 , VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.61 Å R-free 0.238
3TWH Selenium Derivatized RNA/DNA Hybrid in complex with RNase H Catalytic Domain D132N Mutant Deposited 2011-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：catalytic domain	Mutation：D132N	MG MAGNESIUM ION × 2 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M MES, 12% PEG 20000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.79 Å R-free 0.208
3ULD High resolution structure of DNA/RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2011-11-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：catalytic domain	Mutation：D132N	MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；0.04 M Magnesium chloride, 0.05 M Sodium cacodylate, 5% MPD, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.60 Å R-free 0.235
4HTU Structure of 5-chlorouracil modified A:U base pair Deposited 2012-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 61–194（134 aa）	Not recorded	MG MAGNESIUM ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate (pH 6.5) and 20% (w/v) PEG 8000, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.49 Å R-free 0.218
4HTU Structure of 5-chlorouracil modified A:U base pair Deposited 2012-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain B 61–194（134 aa）	Not recorded	MG MAGNESIUM ION × 1 GOL GLYCEROL × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate (pH 6.5) and 20% (w/v) PEG 8000, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.49 Å R-free 0.218
4HUE Structure of 5-chlorouracil modified G:U base pair Deposited 2012-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 61–194（134 aa）	Mutation：D132N	GOL GLYCEROL × 3 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate and 20% (w/v) PEG 8000, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.56 Å R-free 0.220
4HUE Structure of 5-chlorouracil modified G:U base pair Deposited 2012-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain B 61–194（134 aa）	Mutation：D132N	GOL GLYCEROL × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate and 20% (w/v) PEG 8000, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.56 Å R-free 0.220
4HUF Structure of 5-chlorouracil modified A:U base pair Deposited 2012-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 61–194（134 aa）	Mutation：D132N	GOL GLYCEROL × 2 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate (pH 6.5) and 20% (w/v) PEG 8000 , VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.69 Å R-free 0.228
4HUF Structure of 5-chlorouracil modified A:U base pair Deposited 2012-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain B 61–194（134 aa）	Mutation：D132N	MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate (pH 6.5) and 20% (w/v) PEG 8000 , VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.69 Å R-free 0.228
4HUG Structure of 5-chlorouracil modified A:U base pairs Deposited 2012-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 61–194（134 aa）	Mutation：D132N	MG MAGNESIUM ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate and 20% (w/v) PEG 8000 , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.64 Å R-free 0.222
4HUG Structure of 5-chlorouracil modified A:U base pairs Deposited 2012-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain B 61–194（134 aa）	Mutation：D132N	MG MAGNESIUM ION × 1 GOL GLYCEROL × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；277 K；0.2 M magnesium acetate, 0.1 M sodium cacodylate and 20% (w/v) PEG 8000 , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.64 Å R-free 0.222
4OPJ Bh-RNaseH:tcdA-DNA complex Deposited 2014-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：UNP residues 59-196	Mutation：D132N	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M sodium acetate, 10% w/v PEG4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.54 Å R-free 0.220
4OPJ Bh-RNaseH:tcdA-DNA complex Deposited 2014-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain C 59–196（138 aa） Fragment：UNP residues 59-196	Mutation：D132N	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M sodium acetate, 10% w/v PEG4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.54 Å R-free 0.220
4OPK Bh-RNaseH:2'-SMe-DNA complex Deposited 2014-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：UNP residues 59-196	Mutation：D132N	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M sodium acetate, 8% w/v PEG4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.54 Å R-free 0.258
4OPK Bh-RNaseH:2'-SMe-DNA complex Deposited 2014-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain C 59–196（138 aa） Fragment：UNP residues 59-196	Mutation：D132N	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.1 M sodium acetate, 8% w/v PEG4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.54 Å R-free 0.258
5SWM BACILLUS HALODURANS RNASE H MUTANT D132N IN COMPLEX WITH 12-MER FRNA/DNA HYBRID Deposited 2016-08-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa）	Mutation：D132N	NA SODIUM ION × 1 CL CHLORIDE ION × 1 PEG DI(HYDROXYETHYL)ETHER × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.4 M ammonium phosphate monobasic	Resolution 1.50 Å R-free 0.185
5SWM BACILLUS HALODURANS RNASE H MUTANT D132N IN COMPLEX WITH 12-MER FRNA/DNA HYBRID Deposited 2016-08-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain B 59–196（138 aa）	Mutation：D132N	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.4 M ammonium phosphate monobasic	Resolution 1.50 Å R-free 0.185
5US2 2-Se-T2-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2017-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：residues 59-196	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M MES pH 6.5, 12%(w/v) PEG 20000	Resolution 1.90 Å R-free 0.227
5USA 5-Se-T2-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2017-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：residues 59-196	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M MES pH 6.5, 12%(w/v) PEG 20000	Resolution 1.80 Å R-free 0.216
5USE 5-Se-T4-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2017-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：residues 59-196	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M MES pH 6.5, 12%(w/v) PEG 20000	Resolution 1.73 Å R-free 0.234
5USG 5-Se-T2/4-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2017-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：residues 59-196	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M MES pH 6.5, 12%(w/v) PEG 20000	Resolution 1.70 Å R-free 0.221
5VAJ BhRNase H - amide-RNA/DNA complex Deposited 2017-03-27	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 59–196（138 aa） Chain B 59–196（138 aa）	Not recorded	GOL GLYCEROL × 9 MG MAGNESIUM ION × 4 ACT ACETATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；291 K；50 mM sodium cacodylate (pH 6.5) and 0.7 M sodium acetate.	Resolution 1.95 Å R-free 0.217
5W7N 2-Se-T2/4-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2017-06-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 62–193（132 aa） Fragment：residues 62-193	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M MES pH 6.5, 12%(w/v) PEG 20000	Resolution 1.80 Å R-free 0.232
5W7O 2-Se-T4-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2017-06-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 62–193（132 aa） Fragment：residues 62-193	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1M MES pH 6.5, 12%(w/v) PEG 20000	Resolution 1.75 Å R-free 0.229
5WJR High resolution native hexamer DNA and RNA hybrid in complex with RNase H catalytic domain D132N mutant Deposited 2017-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：residues 59-196	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1M MES pH 6.5, 12%(w/v) PEG 20000	Resolution 1.70 Å R-free 0.234
6DMN Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Soaked in 2 mM Ca2+ and 200 mM K+ at 21 C Deposited 2018-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa）	Not recorded	CA CALCIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 2 EDO 1,2-ETHANEDIOL × 4 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.27 Å R-free 0.171
6DMV Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Soaked for 40 s in 2 mM Mg2+ and 200 mM K+ at 21 C Deposited 2018-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.52 Å R-free 0.182
6DO8 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 80 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 5 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.41 Å R-free 0.168
6DO9 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 120 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 6 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.36 Å R-free 0.175
6DOA Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 480 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 4 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.47 Å R-free 0.186
6DOB Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 200 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.34 Å R-free 0.196
6DOC Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 240 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.50 Å R-free 0.221
6DOD Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 360 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.53 Å R-free 0.195
6DOE Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 420 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.45 Å R-free 0.198
6DOF Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 540 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.43 Å R-free 0.187
6DOG Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 600 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.28 Å R-free 0.183
6DOH Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Soak in 0.5 mM EGTA and 200 mM K+ at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–193（133 aa） Fragment：Catalytic Domain	Not recorded	CA CALCIUM ION × 1 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.36 Å R-free 0.200
6DOI Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid (1.54 Angstrom wavelength): Soak in 0.5 mM EGTA and 200 mM K+ at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–193（133 aa） Fragment：Catalytic Domain	Not recorded	K POTASSIUM ION × 3 CA CALCIUM ION × 1 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.95 Å R-free 0.195
6DOJ Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 5 mM K+ for 120 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–195（135 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 1 IOD IODIDE ION × 1 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.40 Å R-free 0.185
6DOK Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 25 mM K+ for 120 s at 21 C (dataset 1) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–195（135 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 1 IOD IODIDE ION × 2 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.38 Å R-free 0.170
6DOL Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 25 mM K+ for 120 s at 21 C (dataset 2) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–195（135 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 1 IOD IODIDE ION × 2 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.43 Å R-free 0.185
6DOM Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 50 mM K+ for 120 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 3 GOL GLYCEROL × 5 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.43 Å R-free 0.184
6DON Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 100 mM K+ for 120 s at 21 C (dataset 1) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 3 GOL GLYCEROL × 5 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.42 Å R-free 0.195
6DOO Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 100 mM K+ for 120 s at 21 C (dataset 2) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.44 Å R-free 0.170
6DOP Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 120 s at 21 C (dataset 1) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 6 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.25 Å R-free 0.178
6DOQ Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 120 s at 21 C (dataset 2) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.42 Å R-free 0.177
6DOR Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 300 mM K+ for 120 s at 21 C (dataset 1) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 5 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.50 Å R-free 0.194
6DOS Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 300 mM K+ for 120 s at 21 C (dataset 2) Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–195（135 aa） Fragment：catalytic domain (UNP residues 61-196)	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 6 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM potassium iodide, 5 mM calcium chloride	Resolution 1.32 Å R-free 0.171
6DOT Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 200 mM Rb+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 3 CL CHLORIDE ION × 3 GOL GLYCEROL × 5 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.42 Å R-free 0.168
6DOU Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 200 mM Rb+ for 120 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 5 CL CHLORIDE ION × 3 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.49 Å R-free 0.188
6DOV Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 200 mM Rb+ for 80 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 5 CL CHLORIDE ION × 3 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.52 Å R-free 0.190
6DOW Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 200 mM Rb+ for 160 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 5 CL CHLORIDE ION × 3 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.50 Å R-free 0.198
6DOX Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 200 mM Rb+ for 360 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 5 CL CHLORIDE ION × 3 GOL GLYCEROL × 5 EDO 1,2-ETHANEDIOL × 6 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.45 Å R-free 0.175
6DOY Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM Li+ for 120 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	IOD IODIDE ION × 4 GOL GLYCEROL × 2 EDO 1,2-ETHANEDIOL × 8 LI LITHIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.45 Å R-free 0.187
6DOZ Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 1 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain residues 59-196	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 3 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.57 Å R-free 0.185
6DP0 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2.5 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–195（135 aa） Fragment：Catalytic Domain residues 61-195	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.45 Å R-free 0.236
6DP1 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain residues 59-196	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.42 Å R-free 0.190
6DP2 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 7.5 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain residues 59-196	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.66 Å R-free 0.196
6DP3 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 10 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain residues 59-196	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 3 GOL GLYCEROL × 9 EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.46 Å R-free 0.198
6DP4 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 20 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain residues 59-196	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 3 GOL GLYCEROL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.37 Å R-free 0.176
6DP5 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 40 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain residues 59-196	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.43 Å R-free 0.176
6DP6 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 80 mM Mg2+ and 75 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain residues 59-196	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.40 Å R-free 0.186
6DP7 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 500 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–195（135 aa）	Not recorded	MN MANGANESE (II) ION × 4 K POTASSIUM ION × 1 IOD IODIDE ION × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.38 Å R-free 0.192
6DP8 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 200 mM Li+ for 240 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 LI LITHIUM ION × 1 CL CHLORIDE ION × 3 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 6 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.32 Å R-free 0.170
6DP9 Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa）	Not recorded	MN MANGANESE (II) ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.40 Å R-free 0.184
6DPA Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 4 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa）	Not recorded	MN MANGANESE (II) ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.49 Å R-free 0.186
6DPB Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 8 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa）	Not recorded	MN MANGANESE (II) ION × 4 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.32 Å R-free 0.172
6DPC Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 12 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa）	Not recorded	MN MANGANESE (II) ION × 5 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.34 Å R-free 0.180
6DPD Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 16 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa）	Not recorded	MN MANGANESE (II) ION × 6 K POTASSIUM ION × 1 IOD IODIDE ION × 5 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 4 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.46 Å R-free 0.173
6DPE Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 20 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa）	Not recorded	MN MANGANESE (II) ION × 5 K POTASSIUM ION × 1 IOD IODIDE ION × 5 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 4 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.56 Å R-free 0.217
6DPF Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 40 mM Mn2+ and 200 mM K+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa）	Not recorded	MN MANGANESE (II) ION × 5 IOD IODIDE ION × 5 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 4 PGE TRIETHYLENE GLYCOL × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.56 Å R-free 0.207
6DPG Crystal Structure of Bacillus Halodurans Ribonuclease H1 E188A in Complex with an RNA/DNA Hybrid: Reaction in 4 mM Mn2+ and 200 mM K+ for 240 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：E188A	MN MANGANESE (II) ION × 4 IOD IODIDE ION × 3 GOL GLYCEROL × 2 EDO 1,2-ETHANEDIOL × 4 K POTASSIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.38 Å R-free 0.175
6DPH Crystal Structure of Bacillus Halodurans Ribonuclease H1 E188A in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mn2+ and 200 mM K+ for 120 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：E188A	MG MAGNESIUM ION × 2 K POTASSIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 4 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.34 Å R-free 0.192
6DPI Crystal Structure of Bacillus Halodurans Ribonuclease H1 K196A in Complex with an RNA/DNA Hybrid: Reaction in 10 mM Mg2+ and 200 mM Rb+ for 40 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：K196A	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 3 CL CHLORIDE ION × 3 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.35 Å R-free 0.174
6DPJ Crystal Structure of Bacillus Halodurans Ribonuclease H1 K196A in Complex with an RNA/DNA Hybrid: Reaction in 4 mM Mn2+ and 200 mM K+ for 80 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：K196A	MN MANGANESE (II) ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 EDO 1,2-ETHANEDIOL × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.55 Å R-free 0.211
6DPK Crystal Structure of Bacillus Halodurans Ribonuclease H1 K196A in Complex with an RNA/DNA Hybrid: Reaction in 4 mM Mn2+ and 200 mM K+ for 240 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：K196A	MN MANGANESE (II) ION × 4 IOD IODIDE ION × 3 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 5 K POTASSIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.39 Å R-free 0.169
6DPL Crystal Structure of Bacillus Halodurans Ribonuclease H1 K196A in Complex with an RNA/DNA Hybrid: Reaction in 10 mM Mg2+ and 200 mM Rb+ for 720 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：K196A	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 6 CL CHLORIDE ION × 3 GOL GLYCEROL × 6 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.45 Å R-free 0.179
6DPM Crystal Structure of Bacillus Halodurans Ribonuclease H1 K196A in Complex with an RNA/DNA Hybrid: Reaction in 10 mM Mg2+ and 200 mM Rb+ for 1800 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：K196A	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 6 CL CHLORIDE ION × 3 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.68 Å R-free 0.199
6DPN Crystal Structure of Bacillus Halodurans Ribonuclease H1 E188A in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 200 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：E188A	MG MAGNESIUM ION × 2 K POTASSIUM ION × 2 IOD IODIDE ION × 4 GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.49 Å R-free 0.179
6DPO Crystal Structure of Bacillus Halodurans Ribonuclease H1 E188A in Complex with an RNA/DNA Hybrid: Reaction in 2 mM Mg2+ and 200 mM K+ for 360 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 59–196（138 aa） Fragment：Catalytic Domain	Mutation：E188A	MG MAGNESIUM ION × 3 IOD IODIDE ION × 4 GOL GLYCEROL × 5 EDO 1,2-ETHANEDIOL × 3 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.45 Å R-free 0.186
6DPP Crystal Structure of Bacillus Halodurans Ribonuclease H1 in Complex with an RNA/DNA Hybrid: Reaction in 5 mM Mg2+ and 200 mM Rb+ for 240 s at 21 C Deposited 2018-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 61–196（136 aa） Fragment：Catalytic Domain	Not recorded	MG MAGNESIUM ION × 2 RB RUBIDIUM ION × 5 CL CHLORIDE ION × 3 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；14% PEG3350, 20% glycerol, 200 mM KI, and 25 mM CaCl2	Resolution 1.45 Å R-free 0.171
8CTZ 12-mer DNA structure of ExBIM & O6Me-G bound to RNase-H Deposited 2022-05-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 3 PDB declaration: pentameric	Chain A 59–196（138 aa） Chain B 59–196（138 aa） Chain C 59–196（138 aa）	Mutation：D132N Mutation：D132N Mutation：D132N	GOL GLYCEROL × 4 EDO 1,2-ETHANEDIOL × 3 ACT ACETATE ION × 2 NA SODIUM ION × 1 K POTASSIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；0.1 M HEPES, 10% v/v 2-propanol and 20% w/v PEG 4000	Resolution 2.32 Å R-free 0.265
8CU0 12-mer DNA structure of ExBIM bound to RNaseH -modified DDD Deposited 2022-05-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 3 PDB declaration: pentameric	Chain A 59–196（138 aa） Chain B 59–196（138 aa） Chain C 59–196（138 aa）	Mutation：D132N Mutation：D132N Mutation：D132N	EDO 1,2-ETHANEDIOL × 5 GOL GLYCEROL × 3 NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.2 M sodium acetate trihydrate, 0.1 M sodium cacodylate trihydrate, 30% PEG 8000 (W/V)	Resolution 1.74 Å R-free 0.246
8SV3 7-Deazapurines and 5-Halogenpyrimidine DNA duplex Deposited 2023-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa）	Mutation：D132N	MG MAGNESIUM ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；291 K；2 M Ammonium Sulphate	Resolution 1.51 Å R-free 0.210
8SV3 7-Deazapurines and 5-Halogenpyrimidine DNA duplex Deposited 2023-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 59–196（138 aa）	Mutation：D132N	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；291 K；2 M Ammonium Sulphate	Resolution 1.51 Å R-free 0.210
8SV3 7-Deazapurines and 5-Halogenpyrimidine DNA duplex Deposited 2023-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 59–196（138 aa）	Mutation：D132N	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；291 K；2 M Ammonium Sulphate	Resolution 1.51 Å R-free 0.210
8SV4 7-Deazapurines and 5-Halogenpyrimidine DNA duplex Deposited 2023-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa）	Mutation：D132N	FWN 2-[2-(2-ethoxyethoxy)ethoxy]ethanol × 1 ACT ACETATE ION × 2 SO4 SULFATE ION × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；0.2 M Ammonium Sulfate, 0.1 M Sodium acetate trihydrate and 25% (w/v) PEG 4000	Resolution 2.30 Å R-free 0.254
9YJL Joint X-ray/neutron structure of wild-type Bacillus halodurans RNase H1 in the apo-form Deposited 2025-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 59–196（138 aa）	Not recorded	SO4 SULFATE ION × 1	Experimental method not declared X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；0.1 M NaOAc pH 5.0, 0.2 M (NH4)2SO4, and 20% PEG 3350	Resolution not provided
9YJM Joint X-ray/neutron structure of D132N Bacillus halodurans RNase H1 in the apo-form Deposited 2025-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 59–196（138 aa）	Mutation：D132N	SO4 SULFATE ION × 1	Experimental method not declared X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；0.1 M NaOAc pH 5.0, 0.2 M (NH4)2SO4, and 20% PEG 3350	Resolution not provided
9YK1 Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with RNA/DNA duplex Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa）	Not recorded	MG MAGNESIUM ION × 1 PO3 PHOSPHITE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES pH 7.5, 0.2 M NaCl, and 12-16% PEG 10,000	Resolution 1.80 Å R-free 0.216
9YK3 Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa）	Mutation：D132N	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES pH 7.5, 0.2 M NaCl, and 12-16% PEG 10,000	Resolution 1.90 Å R-free 0.231
9YK5 100K X-ray structure of mixed metal D132N Bacillus halodurans RNase H1 complex with RNA/DNA duplex Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: trimeric	Chain A 59–196（138 aa）	Not recorded	MN MANGANESE (II) ION × 1 MG MAGNESIUM ION × 1 PO3 PHOSPHITE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES pH 7.5, 0.2 M NaCl, and 12-16% PEG 10,000	Resolution 2.00 Å R-free 0.278

95 other PDB entries and 106 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RNH1_BACHD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–142； UniProt 59–196 Author chain B； PDBConstruct 5–142； UniProt 59–196 Author chain C； PDBConstruct 5–142； UniProt 59–196 Author chain D； PDBConstruct 5–142； UniProt 59–196 Author chain E； PDBConstruct 5–142； UniProt 59–196 Author chain F； PDBConstruct 5–142； UniProt 59–196 Author chain G； PDBConstruct 5–142； UniProt 59–196 Author chain H； PDBConstruct 5–142； UniProt 59–196

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8cty
Deposition date deposition_date	2022-05-16
Structure title title	12-mer DNA structure of ExBIM bound to RNase-H
Keywords keywords	;alkylation, base stacking, DNA damage, H-bonding, O6-methyl-2'-deoxyguanosine, ExBIM, DNA ;; DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	44.08 Å
Radius of gyration Rg (electron density) rg_electron	43.90 Å
Forward intensity I(0) i0	347775000.00
Molecular weight molecular_weight	142600.0 kDa
Excluded volume excluded_volume	174310 Å³
Envelope volume envelope_volume	263170 Å³
Hydration-shell volume shell_volume	52536 Å³
Envelope diameter envelope_diameter	163.0 Å
Shell Rg shell_rg	45.96 Å
Envelope Rg envelope_rg	42.99 Å
Shape Rg shape_rg	43.89 Å
Total Rg total_rg	44.06 Å
Total atoms total_atoms	9998
Residues n_residues	1109
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	153.2 Å
Rg (real space) rg_real	44.18 Å
Rg uncertainty (real space) rg_real_error	1.93 Å
I(0) (real space) i0_real	3.4780e+08
I(0) uncertainty (real space) i0_real_error	7.4290e+06
Rg (reciprocal space) rg_reciprocal	44.08 Å
I(0) (reciprocal space) i0_reciprocal	347700000.0000
Solution quality estimate total_estimate	0.8762
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	51.1 Å
Skewness Skewness skewness	0.362
Kurtosis Kurtosis kurtosis	-0.295
Angular range angular_range	— – 0.1800 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	15400000.0000
Real-space data points n_real_points	37
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.851; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.970; Smooth: 0.863

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Ribonuclease H
Molecular weight formula_weight	16329.5 kDa
EC 编号 ec_number	3.1.26.4
Mutation mutation	D132N
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	10263

GSHMAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK

来源 Source

来源生物 organism	Halalkalibacterium halodurans
NCBI Class编号 ncbi_taxonomy_id	86665
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(CPGPCPGPAPAPTPTP(OWR)PGPCPG)-3') ;
Molecular weight formula_weight	3720.5 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	I,J,K,L,M,N

CGCGAATTXGCG

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 6 Entity 6 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 9 Entity 9 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	265

▶

8. Citations (1)

▶

Unit-cell length a length_a	64.976 Å
Unit-cell length b length_b	65.834 Å
Unit-cell length c length_c	95.723 Å
Unit-cell angle α angle_alpha	84.54 °
Unit-cell angle β angle_beta	88.20 °
Unit-cell angle γ angle_gamma	62.49 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	32.730 Å
R factor r_factor	0.1989
R_work r_work	0.1958
R_free r_free	0.2606

fit	/app/data/saxs_computation/ct/8cty/8cty.fit
pddf	/app/data/pr_computation/ct/8cty/8cty.pr.out
profile	/app/data/saxs_computation/ct/8cty/8cty.dat

12-mer DNA structure of ExBIM bound to RNase-H

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonuclease H

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)