SAXSdb — 9ebw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green fluorescent protein,Methyl-accepting chemotaxis transducer (TlpC)

Aequorea victoria

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	GLYCEROL × 2 LACTIC ACID × 1 water × 2	Consistent with protein count
2	Insufficient information	Homooligomer	Protein 2	LACTIC ACID × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O24911_HELPY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 159–421； UniProt 30–292 Author chain B； PDBConstruct 159–421； UniProt 30–292 Author chain C； PDBConstruct 159–421； UniProt 30–292 Author chain D； PDBConstruct 159–421； UniProt 30–292

Green fluorescent protein,Methyl-accepting chemotaxis transducer (TlpC)

Aequorea victoria

UniProt P42212

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	GLYCEROL × 2 LACTIC ACID × 1 water × 2	Consistent with protein count
2	Insufficient information	Homooligomer	Protein 2	LACTIC ACID × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFP_AEQVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 11–153； UniProt 2–146 Author chain A； PDBConstruct 426–515； UniProt 149–238 Author chain B； PDBConstruct 11–153； UniProt 2–146 Author chain B； PDBConstruct 426–515； UniProt 149–238 Author chain C； PDBConstruct 11–153； UniProt 2–146 Author chain C； PDBConstruct 426–515； UniProt 149–238 Author chain D； PDBConstruct 11–153； UniProt 2–146 Author chain D； PDBConstruct 426–515； UniProt 149–238

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ebw
Deposition date deposition_date	2024-11-13
Structure title title	Chimeric fluorescence biosensor formed from a lactate-binding protein and GFP, bound to lactate
Keywords keywords	Biosensor, Binding protein, Fluorescent Protein, Chimera; FLUORESCENT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ebw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ebw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ebw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.36 Å
Rg (electron density)	32.45 Å
Total Rg	33.03 Å
Atom count	7487
Residues	978
Excluded volume	132660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ebw__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9ebw__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Green fluorescent protein,Methyl-accepting chemotaxis transducer (TlpC)
Molecular weight formula_weight	58441.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	14730

MKHHHHHHHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLXVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNSSGRTGIDPFTESVLQSQATELLQKKAQLVSFKIQGIMKRIFMGANTLEKFLSDENSAINDTLKRRMLSEFLLANPHVLLVSAIYTNNNERVITAMSMDSKIAYPNTTLNENMTNQIRSLKSITHSDPYYKEVNGDKIYGMDITLPLMGKNQNAIGALNFFLNIDAFYTDVVGKKKSNTFLMGKDGRLLINPNREIQDKILSAINPDRRVAKAVEYYNQNEAGTLSYHSLSGNTETFLAIQPFDFFEEKGNNGNHWRWAIGKYVNKSLVFSSHSNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYQ

Source Source

Source organism organism	Aequorea victoria
NCBI taxonomy ID ncbi_taxonomy_id	6100
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	LACTIC ACID
Molecular weight formula_weight	90.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	119

▶

Unit-cell length a length_a	90.878 Å
Unit-cell length b length_b	109.803 Å
Unit-cell length c length_c	123.711 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	110.14 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.780 Å
Low-resolution limit resolution_low	45.940 Å
R factor r_factor	0.2437
R_work r_work	0.2422
R_free r_free	0.2848

Chimeric fluorescence biosensor formed from a lactate-binding protein and GFP, bound to lactate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green fluorescent protein,Methyl-accepting chemotaxis transducer (TlpC)

State in the Current Structure

Other States of the Same Protein in the Database

Green fluorescent protein,Methyl-accepting chemotaxis transducer (TlpC)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ebw__assembly_1__model_1

9ebw__assembly_1__model_1 | I(q)

9ebw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Chimeric fluorescence biosensor formed from a lactate-binding protein and GFP, bound to lactate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green fluorescent protein,Methyl-accepting chemotaxis transducer (TlpC)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Green fluorescent protein,Methyl-accepting chemotaxis transducer (TlpC)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ebw__assembly_1__model_1

9ebw__assembly_1__model_1 | I(q)

9ebw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)