9w2t

Cryo-EM structure of Fo domain of FoF1-ATPase monomer state on the bovine heart submitochondrial particles

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase F(0) complex subunit 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP8_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 8； PDBConstruct 1–41； UniProt 1–41

ATP synthase F(0) complex subunit C1, mitochondrial

OrganismNot specified

UniProt P32876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AT5G1_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain K； PDBConstruct 1–75； UniProt 62–136 Author chain L； PDBConstruct 1–75； UniProt 62–136 Author chain M； PDBConstruct 1–75； UniProt 62–136 Author chain N； PDBConstruct 1–75； UniProt 62–136 Author chain O； PDBConstruct 1–75； UniProt 62–136 Author chain P； PDBConstruct 1–75； UniProt 62–136 Author chain Q； PDBConstruct 1–75； UniProt 62–136 Author chain R； PDBConstruct 1–75； UniProt 62–136

ATP synthase F(0) complex subunit a

OrganismNot specified

UniProt P00847

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP6_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain a； PDBConstruct 1–224； UniProt 3–226

ATP synthase peripheral stalk subunit b, mitochondrial

OrganismNot specified

UniProt P13619

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AT5F1_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain b； PDBConstruct 1–112； UniProt 43–154

ATP synthase peripheral stalk subunit d, mitochondrial

OrganismNot specified

UniProt P13620

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5H_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain d； PDBConstruct 1–51； UniProt 110–160

ATP synthase F(0) complex subunit e, mitochondrial

OrganismNot specified

UniProt Q00361

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5I_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain e； PDBConstruct 1–69； UniProt 3–71

ATP synthase F(0) complex subunit f, mitochondrial

OrganismNot specified

UniProt Q28851

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPK_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain f； PDBConstruct 1–83； UniProt 6–88

ATP synthase F(0) complex subunit g, mitochondrial

OrganismNot specified

UniProt Q28852

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5L_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain g； PDBConstruct 1–79； UniProt 21–99

ATP synthase F(0) complex subunit j, mitochondrial

OrganismNot specified

UniProt P14790

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit k, mitochondrial × 1 （Q3ZBI7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP68_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain j； PDBConstruct 1–48； UniProt 2–49

ATP synthase F(0) complex subunit k, mitochondrial

OrganismNot specified

UniProt Q3ZBI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	ATP synthase F(0) complex subunit 8 × 1 （P03929） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P32876） ATP synthase F(0) complex subunit a × 1 （P00847） ATP synthase peripheral stalk subunit b, mitochondrial × 1 （P13619） ATP synthase peripheral stalk subunit d, mitochondrial × 1 （P13620） ATP synthase F(0) complex subunit e, mitochondrial × 1 （Q00361） ATP synthase F(0) complex subunit f, mitochondrial × 1 （Q28851） ATP synthase F(0) complex subunit g, mitochondrial × 1 （Q28852） ATP synthase F(0) complex subunit j, mitochondrial × 1 （P14790）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPMK_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain k； PDBConstruct 1–36； UniProt 13–48

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9w2t
Deposition date deposition_date	2025-07-28
Structure title title	Cryo-EM structure of Fo domain of FoF1-ATPase monomer state on the bovine heart submitochondrial particles
Keywords keywords	ATP synthase, FoF1-ATPase, submitochondrial particles, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9w2t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9w2t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9w2t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.28 Å
Rg (electron density)	36.67 Å
Total Rg	37.18 Å
Atom count	10026
Residues	1307
Excluded volume	184080 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9w2t__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	ATP synthase F(0) complex subunit 8
Molecular weight formula_weight	4901.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8
Atom count atom_count	10026

MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTP

Entity 2 Entity 2 polymer

Description description	ATP synthase F(0) complex subunit C1, mitochondrial
Molecular weight formula_weight	7653.0 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P,Q,R

DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Entity 3 Entity 3 polymer

Description description	ATP synthase F(0) complex subunit a
Molecular weight formula_weight	24556.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

ENLFTSFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSIHNSKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNKTKASLAHFLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT

Entity 4 Entity 4 polymer

Description description	ATP synthase peripheral stalk subunit b, mitochondrial
Molecular weight formula_weight	12462.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

PVPPLPEHGGKVRFGLIPEEFFQFLYPKTGVTGPYVLGTGLILYLLSKEIYVITPETFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEK

Entity 5 Entity 5 polymer

Description description	ATP synthase peripheral stalk subunit d, mitochondrial
Molecular weight formula_weight	6392.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

TRIQEYEKELEKMRNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHRPIET

Entity 6 Entity 6 polymer

Description description	ATP synthase F(0) complex subunit e, mitochondrial
Molecular weight formula_weight	8106.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

PPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKRDEQKRIERELAEAQEDTILK

Entity 7 Entity 7 polymer

Description description	ATP synthase F(0) complex subunit f, mitochondrial
Molecular weight formula_weight	9827.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

PLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGLSMVLAAYVFLNYCRSYKELKHERLRKYH

Entity 8 Entity 8 polymer

Description description	ATP synthase F(0) complex subunit g, mitochondrial
Molecular weight formula_weight	8896.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

TYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGII

Entity 9 Entity 9 polymer

Description description	ATP synthase F(0) complex subunit j, mitochondrial
Molecular weight formula_weight	5687.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

LQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALK

Entity 10 Entity 10 polymer

Description description	ATP synthase F(0) complex subunit k, mitochondrial
Molecular weight formula_weight	4124.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

TGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.100 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	111365

Cryo-EM structure of Fo domain of FoF1-ATPase monomer state on the bovine heart submitochondrial particles

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase F(0) complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit C1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase peripheral stalk subunit b, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase peripheral stalk subunit d, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit e, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit f, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit g, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit j, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit k, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer