2hl3

Crystal structure of the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) in complex with human EB1 C-terminal hexapeptide

Method: X-RAY DIFFRACTION D_max: 65.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dynactin-1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 15–111 Chain B； UniProt 15–111	Fragment：CAP-Gly domain Mutation：A49M	Microtubule-associated protein RP/EB family member 1 × 1 （Q15691）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；25% PEG 3350, 0.05M Sodium Citrate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.03 Å R-free 0.223

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2HL3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1TXQ Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued Deposited 2004-07-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 15–107（93 aa） Fragment：p150Glued CAP-Gly domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；ammonium sulphate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.243
2COY Solution structure of the CAP-Gly domain in human Dynactin 1 Deposited 2005-05-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–99（99 aa） Fragment：CAP-Gly domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120；Pressure ambient NMR sample composition 1mM protein, 20mM d-Tris-HCl, pH7.0, 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2HKN Crystal structure of the CAP-Gly domain of human Dynactin-1 (p150-Glued) Deposited 2006-07-05	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 15–111（97 aa） Fragment：CAP-Gly domain Chain B 15–111（97 aa） Fragment：CAP-Gly domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；25% PEG 3350, 0.05M sodium citrate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.87 Å R-free 0.251
2HKQ Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly domain of human Dynactin-1 (p150-Glued) Deposited 2006-07-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 15–111（97 aa） Fragment：CAP-Gly domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.3 M Trisodium Citrate, 0.1M HEPES Buffer, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.86 Å R-free 0.217
2HL5 Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) Deposited 2006-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 18–111（94 aa） Fragment：CAP-Gly domain Chain D 18–111（94 aa） Fragment：CAP-Gly domain	Mutation：A49M Mutation：A49M	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；25% PEG 3350, 0.1M HEPES, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.93 Å R-free 0.242
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
2HQH Crystal structure of p150Glued and CLIP-170 Deposited 2006-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107 Chain B 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107 Chain C 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107 Chain D 15–107（93 aa） Fragment：CAP-Gly domain, residues 15-107	Not recorded	ZN ZINC ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4M sodium formate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 18–111（94 aa） Fragment：CAP-Gly domain	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 18–111（94 aa） Fragment：CAP-Gly domain	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 18–111（94 aa） Fragment：CAP-Gly domain	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 18–111（94 aa） Fragment：CAP-Gly domain	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3E2U Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED) Deposited 2008-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 18–111（94 aa） Fragment：CAP-Gly domain Chain B 18–111（94 aa） Fragment：CAP-Gly domain Chain C 18–111（94 aa） Fragment：CAP-Gly domain Chain D 18–111（94 aa） Fragment：CAP-Gly domain	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.2M Trisodium Citrate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.238
3TQ7 EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued Deposited 2011-09-09	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain P 27–97（71 aa） Fragment：CAP-Gly domain of P150glued Chain Q 27–97（71 aa） Fragment：CAP-Gly domain of P150glued	Mutation：A49M Mutation：A49M	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；15% PEG 4000, 0.1M Tris-HCl, 0.2M Magnesium chloride hexahydrate, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.30 Å R-free 0.281
9B7J Cryo-EM structure of human dynactin complex bound to Chlamydia effector Dre1 Deposited 2024-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain S 1–1278（1278 aa） Chain s 1–1278（1278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.49 Å
9YND Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B and LIS1 Deposited 2025-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–1278（1278 aa） Chain I 1–1278（1278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.26 Å
9YNE Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B-ICD and LIS1 Deposited 2025-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain F 1–1278（1278 aa） Chain G 1–1278（1278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.46 Å
9YNH Full-length human cytoplasmic dynein-1 in phi-like state bound to dynactin-p150glued and LIS1 Deposited 2025-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain W 1–1278（1278 aa） Chain X 1–1278（1278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å

12 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DYNA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–97； UniProt 15–111 Author chain B； PDBConstruct 4–97； UniProt 15–111

Microtubule-associated protein RP/EB family member 1

OrganismNot specified

UniProt Q15691

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 262–267	Fragment：C-terminal hexapeptide	Dynactin-1 × 2 （Q14203）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；25% PEG 3350, 0.05M Sodium Citrate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.03 Å R-free 0.223

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 2HL3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1PA7 Crystal structure of amino-terminal microtubule binding domain of EB1 Deposited 2003-05-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–130（130 aa） Fragment：N-terminal domain, EB1 microtubule-binding domain	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；PEG4K, ammonium sulfate, MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.45 Å R-free 0.189
1TXQ Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued Deposited 2004-07-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 183–268（86 aa） Fragment：EB1 C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；ammonium sulphate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.243
1UEG Crystal structure of amino-terminal microtubule binding domain of EB1 Deposited 2003-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–130（130 aa） Fragment：N-terminal domain, EB1 microtubule-binding domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；ammonium sulfate, sodium citrate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.40 Å R-free 0.279
1VKA Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691 N-Terminal Fragment Deposited 2004-05-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–140（139 aa） Fragment：N-terminal domain Chain B 2–140（139 aa） Fragment：N-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions Micro-batch under oil；pH 6.2；291 K；pH 6.2, Micro-batch under oil, temperature 291K	Resolution 1.60 Å R-free 0.214
1WU9 Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1) Deposited 2004-12-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 190–267（78 aa） Fragment：C-terminal domain Chain B 190–267（78 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；sodium citrate, PEG 3350, gamma-butyrolactone, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.54 Å R-free 0.220
1YIB Crystal Structure of the Human EB1 C-terminal Dimerization Domain Deposited 2005-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 184–254（71 aa） Fragment：EB1 C-terminal Domain	Mutation：N-terminal cloning artifact GPLGS	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；protein stock = EB1 C-terminal domain @ 15 mg/ml, MACF2 (1595-1637) peptide @ 8 mg/ml, well = 22% PEG 200 (v/v), 100 mM ammonium acetate pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.80 Å R-free 0.259
1YIG Crystal Structure of the Human EB1 C-terminal Dimerization Domain Deposited 2005-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 184–254（71 aa） Fragment：EB1 C-terminal Domain Chain B 184–254（71 aa） Fragment：EB1 C-terminal Domain	Mutation：N-terminal cloning artifact GPLGS, V243M mutant, methionines at positions 197 and 243 are seleno-methionines Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：N-terminal cloning artifact GPLGS, V243M mutant, methionines at positions 197 and 243 are seleno-methionines Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；protein stock = EB1 C-terminal domain @15 mg/ml, well = 22%, PEG 200 (v/v), 100 mM ammonium acetate pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.251
2HKQ Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly domain of human Dynactin-1 (p150-Glued) Deposited 2006-07-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 188–267（80 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.3 M Trisodium Citrate, 0.1M HEPES Buffer, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.86 Å R-free 0.217
2HL5 Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) Deposited 2006-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 190–267（78 aa） Fragment：C-terminal domain Chain B 190–267（78 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；25% PEG 3350, 0.1M HEPES, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.93 Å R-free 0.242
2QJZ Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1 Deposited 2007-07-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 12–133（122 aa） Fragment：Calponin Homology Domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；11.5% 2-propanol, 190 mM Sodium citrate, 100 mM Hepes, Protein concentration 20 mg/ml, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.25 Å R-free 0.198
2QJZ Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1 Deposited 2007-07-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 12–133（122 aa） Fragment：Calponin Homology Domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；11.5% 2-propanol, 190 mM Sodium citrate, 100 mM Hepes, Protein concentration 20 mg/ml, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.25 Å R-free 0.198
2R8U Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution Deposited 2007-09-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–268（268 aa） Fragment：N-terminal domain	Not recorded	MOO MOLYBDATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1M Tris, 0.1M Na2MoO4, 35% PEG4000, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 1.35 Å R-free 0.227
2R8U Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution Deposited 2007-09-11	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–268（268 aa） Fragment：N-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1M Tris, 0.1M Na2MoO4, 35% PEG4000, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 1.35 Å R-free 0.227
3GJO Crystal structure of human EB1 in complex with microtubule Tip localization signal peptide of MACF Deposited 2009-03-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 191–260（70 aa） Fragment：EB1 C-TERMINAL DOMAIN, UNP RESIDUES 191-260 Chain B 191–260（70 aa） Fragment：EB1 C-TERMINAL DOMAIN, UNP RESIDUES 191-260	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；298 K；0.2M MAGNESIUM ACETATE, 20% PEG 3350, pH 7.40, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.50 Å R-free 0.255
3GJO Crystal structure of human EB1 in complex with microtubule Tip localization signal peptide of MACF Deposited 2009-03-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 191–260（70 aa） Fragment：EB1 C-TERMINAL DOMAIN, UNP RESIDUES 191-260 Chain D 191–260（70 aa） Fragment：EB1 C-TERMINAL DOMAIN, UNP RESIDUES 191-260	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；298 K；0.2M MAGNESIUM ACETATE, 20% PEG 3350, pH 7.40, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.50 Å R-free 0.255
3MTU Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle Deposited 2010-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ; Chain B 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ; Chain C 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ; Chain D 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ;	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2 EDO 1,2-ETHANEDIOL × 9 EOH ETHANOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；16% MePEG 5000, 100 mM MES, pH 6.0, 140 mM CaCl2, 2% methanol , VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.10 Å R-free 0.241
3MTU Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle Deposited 2010-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ; Chain B 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ; Chain C 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ; Chain D 216–257（42 aa） Fragment：;Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein,Fusion protein of residues 1-29 of chicken smooth muscle tropomyosin and residues 215-257 of human EB1 protein ;	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2 EDO 1,2-ETHANEDIOL × 9 EOH ETHANOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；16% MePEG 5000, 100 mM MES, pH 6.0, 140 mM CaCl2, 2% methanol , VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.10 Å R-free 0.241
3MUD Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle Deposited 2010-05-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 215–257（43 aa） Chain D 215–257（43 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；18% MePEG 2000, 100 mM Bis-Tris, 120 mM MgSO4 , pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.250
3TQ7 EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued Deposited 2011-09-09	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 191–268（78 aa） Fragment：EB1 c-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；15% PEG 4000, 0.1M Tris-HCl, 0.2M Magnesium chloride hexahydrate, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.30 Å R-free 0.281
4XA1 Crystal Structure of the coiled-coil surrounding Skip 1 of MYH7 Deposited 2014-12-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 211–251（41 aa） Fragment：UNP P13848 residues 1-49,UNP Q12883 residues 1173-1238,UNP Q15691 residues 211-251 Chain B 211–251（41 aa） Fragment：UNP P13848 residues 1-49,UNP Q12883 residues 1173-1238,UNP Q15691 residues 211-251	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；298 K；20% (w/v) polyethylene glycol methyl ether 2000, 20 mM SrCl2, 100 mM HEPES pH 7.6, 5% pentaerythritol ethoxylate (17/8 PO/OH) 797, 0.5% 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS)	Resolution 3.20 Å R-free 0.285
4XA1 Crystal Structure of the coiled-coil surrounding Skip 1 of MYH7 Deposited 2014-12-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 211–251（41 aa） Fragment：UNP P13848 residues 1-49,UNP Q12883 residues 1173-1238,UNP Q15691 residues 211-251 Chain D 211–251（41 aa） Fragment：UNP P13848 residues 1-49,UNP Q12883 residues 1173-1238,UNP Q15691 residues 211-251	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；298 K；20% (w/v) polyethylene glycol methyl ether 2000, 20 mM SrCl2, 100 mM HEPES pH 7.6, 5% pentaerythritol ethoxylate (17/8 PO/OH) 797, 0.5% 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS)	Resolution 3.20 Å R-free 0.285
4XA3 Crystal structure of the coiled-coil surrounding Skip 2 of MYH7 Deposited 2014-12-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 215–251（37 aa） Fragment：UNP P13848 residues 1-49,UNP P12883 residues 1361-1425,UNP Q15691 residues 215-251 Chain B 215–251（37 aa） Fragment：UNP P13848 residues 1-49,UNP P12883 residues 1361-1425,UNP Q15691 residues 215-251	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；4.5% (w/v) polyethylene glycol 8000, 100 mM sodium acetate pH 5.0, 50 mM CaCl2, 2.5% (w/v) 3-methoxy-3-methyl-1-butanol	Resolution 2.55 Å R-free 0.311
4XA6 Crystal Structure of the coiled-coil surrounding Skip 4 of MYH7 Deposited 2014-12-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 209–251（43 aa） Fragment：UNP P13848 residues 2-50,UNP P02564 residues 1777-1855,UNP Q15691 residues 209-251 Chain B 209–251（43 aa） Fragment：UNP P13848 residues 2-50,UNP P02564 residues 1777-1855,UNP Q15691 residues 209-251	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；298 K；18% (w/v) polyethylene glycol 2000 methyl ether, 100 mM piperazine-N,N-bis(2-ethanesulfonic acid) (PIPES)	Resolution 3.42 Å R-free 0.297
4XA6 Crystal Structure of the coiled-coil surrounding Skip 4 of MYH7 Deposited 2014-12-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 209–251（43 aa） Fragment：UNP P13848 residues 2-50,UNP P02564 residues 1777-1855,UNP Q15691 residues 209-251 Chain D 209–251（43 aa） Fragment：UNP P13848 residues 2-50,UNP P02564 residues 1777-1855,UNP Q15691 residues 209-251	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；298 K；18% (w/v) polyethylene glycol 2000 methyl ether, 100 mM piperazine-N,N-bis(2-ethanesulfonic acid) (PIPES)	Resolution 3.42 Å R-free 0.297
5JV3 The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1 Deposited 2016-05-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 210–257（48 aa） Fragment：UNP P52732 residues 366-391,UNP Q15691 residues 210-257 Chain B 210–257（48 aa） Fragment：UNP P52732 residues 366-391,UNP Q15691 residues 210-257	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；24% (w/v) PEE797, 100 mM CaCl2, 100 mM MOPS pH 7.0, 0.1% (w/v) octylglucoside	Resolution 2.01 Å R-free 0.247
5JV3 The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1 Deposited 2016-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 210–257（48 aa） Fragment：UNP P52732 residues 366-391,UNP Q15691 residues 210-257 Chain D 210–257（48 aa） Fragment：UNP P52732 residues 366-391,UNP Q15691 residues 210-257	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；24% (w/v) PEE797, 100 mM CaCl2, 100 mM MOPS pH 7.0, 0.1% (w/v) octylglucoside	Resolution 2.01 Å R-free 0.247
5JVM The neck-linker and alpha 7 helix of Mus musculus KIF3C Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 207–257（51 aa） Fragment：UNP O35066 residues 374-402,UNP Q15691 residues 207-257 Chain B 207–257（51 aa） Fragment：UNP O35066 residues 374-402,UNP Q15691 residues 207-257	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；298 K；30% (w/v) pentaerythritol ethoxylate (PEE) 797, 1.5% (w/v) ethylene glycol monoethylether, 400 mM MgCl2, 100 mM bis-tris propane pH 9.0	Resolution 1.57 Å R-free 0.205
5JVP The neck-linker and alpha 7 helix of Homo sapiens CENP-E Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 210–257（48 aa） Fragment：UNP Q02224 residues 336-375,UNP Q15691 residues 210-257	Non-standard monomer：Yes (specific site not provided by mmCIF)	CD CADMIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；18% (w/v) MEPEG 2000, 175 mM Li2SO4, 100 mM MES pH 6.0, 1 mM CdCl2	Resolution 2.10 Å R-free 0.274
5JVP The neck-linker and alpha 7 helix of Homo sapiens CENP-E Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 210–257（48 aa） Fragment：UNP Q02224 residues 336-375,UNP Q15691 residues 210-257	Non-standard monomer：Yes (specific site not provided by mmCIF)	CD CADMIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；18% (w/v) MEPEG 2000, 175 mM Li2SO4, 100 mM MES pH 6.0, 1 mM CdCl2	Resolution 2.10 Å R-free 0.274
5JVP The neck-linker and alpha 7 helix of Homo sapiens CENP-E Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 210–257（48 aa） Fragment：UNP Q02224 residues 336-375,UNP Q15691 residues 210-257 Chain D 210–257（48 aa） Fragment：UNP Q02224 residues 336-375,UNP Q15691 residues 210-257	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；18% (w/v) MEPEG 2000, 175 mM Li2SO4, 100 mM MES pH 6.0, 1 mM CdCl2	Resolution 2.10 Å R-free 0.274
5JVP The neck-linker and alpha 7 helix of Homo sapiens CENP-E Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 210–257（48 aa） Fragment：UNP Q02224 residues 336-375,UNP Q15691 residues 210-257 Chain F 210–257（48 aa） Fragment：UNP Q02224 residues 336-375,UNP Q15691 residues 210-257	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；18% (w/v) MEPEG 2000, 175 mM Li2SO4, 100 mM MES pH 6.0, 1 mM CdCl2	Resolution 2.10 Å R-free 0.274
5JVR The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1 Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257 Chain B 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；32% (w/v) polyethylene glycol dimethyl ether (DMPEG) 500, 30 mM MgCl2, 10 mM diethylenetriamine, 100 mM sodium 3-[4-(2-Hydroxyethyl)-1-piperazinyl]propanesulfonic acid (HEPPS) pH 8.5	Resolution 2.10 Å R-free 0.234
5JVR The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1 Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257 Chain D 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；32% (w/v) polyethylene glycol dimethyl ether (DMPEG) 500, 30 mM MgCl2, 10 mM diethylenetriamine, 100 mM sodium 3-[4-(2-Hydroxyethyl)-1-piperazinyl]propanesulfonic acid (HEPPS) pH 8.5	Resolution 2.10 Å R-free 0.234
5JVR The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1 Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257 Chain F 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；32% (w/v) polyethylene glycol dimethyl ether (DMPEG) 500, 30 mM MgCl2, 10 mM diethylenetriamine, 100 mM sodium 3-[4-(2-Hydroxyethyl)-1-piperazinyl]propanesulfonic acid (HEPPS) pH 8.5	Resolution 2.10 Å R-free 0.234
5JVR The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1 Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257 Chain H 207–257（51 aa） Fragment：UNP P28741 residues 352-359,UNP P17210 residues 345-358,UNP Q15691 residues 207-257	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；32% (w/v) polyethylene glycol dimethyl ether (DMPEG) 500, 30 mM MgCl2, 10 mM diethylenetriamine, 100 mM sodium 3-[4-(2-Hydroxyethyl)-1-piperazinyl]propanesulfonic acid (HEPPS) pH 8.5	Resolution 2.10 Å R-free 0.234
5JVS The neck-linker + DAL and alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1 Deposited 2016-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 207–257（51 aa） Fragment：UNP P17210 residues 334-365,UNP Q15691 residues 207-257	Not recorded	ZN ZINC ION × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；100 mM sodium acetate pH 5.0, 24% (w/v) polyethylene glycol (PEG) 400, 80 mM MgCl2, 3 mM ZnSO4	Resolution 2.25 Å R-free 0.236
5JVU The neck-linker and alpha 7 helix of Drosophila melanogaster kinesin-1 fused to EB1 Deposited 2016-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 207–257（51 aa） Fragment：UNP P17210 residues 334-365,UNP Q15691 residues 207-257 Chain B 207–257（51 aa） Fragment：UNP P17210 residues 334-365,UNP Q15691 residues 207-257	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20% (w/v) methoxy polyethylene glycol (MEPEG) 5000, 100 mM Li2SO4, 100 mM MES/Acetate pH 5.5, 10 mM gamma-caprolactone	Resolution 1.95 Å R-free 0.243
5JX1 The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1 Deposited 2016-05-12	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 210–257（48 aa） Fragment：UNP P28741 residues 352-376,UNP Q15691 residues 210-257	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；24% (w/v) 2-methyl-2,4-pentanediol (MPD), 10% (w/v) PEG 4000, 100 mM CaCl2, 100 mM (3-(N-morpholino)propanesulfonic acid) (MOPS) pH 7.0, 1 mM CdCl2	Resolution 1.67 Å R-free 0.228
5N74 Microtubule end binding protein complex Deposited 2017-02-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 191–248（58 aa） Chain B 191–248（58 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；293 K；100 mM PCTP buffer, pH 4, supplemented with 25% PEG 1500	Resolution 2.30 Å R-free 0.271
5N74 Microtubule end binding protein complex Deposited 2017-02-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 191–248（58 aa） Chain D 191–248（58 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；293 K；100 mM PCTP buffer, pH 4, supplemented with 25% PEG 1500	Resolution 2.30 Å R-free 0.271
5N74 Microtubule end binding protein complex Deposited 2017-02-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 191–248（58 aa） Chain F 191–248（58 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；293 K；100 mM PCTP buffer, pH 4, supplemented with 25% PEG 1500	Resolution 2.30 Å R-free 0.271
5N74 Microtubule end binding protein complex Deposited 2017-02-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 191–248（58 aa） Chain H 191–248（58 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；293 K；100 mM PCTP buffer, pH 4, supplemented with 25% PEG 1500	Resolution 2.30 Å R-free 0.271
5WLQ Crystal Structure of Amino Acids 1677-1755 of Human Beta Cardiac Myosin Fused to Gp7 and Eb1 Deposited 2017-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 208–257（50 aa） Fragment：UNP P13848 residues 2-48 UNP Q15691 residues 208-256, UNP P12883 residues 1677-1755	Not recorded	SO4 SULFATE ION × 2 TMO trimethylamine oxide × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；298 K；1.6 M Ammonium Aulfate, 500 mM Trimethyl Ammonium N-Oxide, 100 mM Bis-tris Propane pH 9.0	Resolution 3.10 Å R-free 0.236
6YF5 Lamin A 17-70 coil1A dimer stabilized by C-terminal capping Deposited 2020-03-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 215–251（37 aa） Chain B 215–251（37 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.9；277 K；35.7% (w/v) 1,6-hexanediol, 5% (w/v) PEG 1K and 0.1 M trisodium citrate dihydrate	Resolution 1.83 Å R-free 0.255
6YF5 Lamin A 17-70 coil1A dimer stabilized by C-terminal capping Deposited 2020-03-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 215–251（37 aa） Chain D 215–251（37 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.9；277 K；35.7% (w/v) 1,6-hexanediol, 5% (w/v) PEG 1K and 0.1 M trisodium citrate dihydrate	Resolution 1.83 Å R-free 0.255
6YSH Lamin A 1-70 coil1A dimer stabilized by C-terminal capping Deposited 2020-04-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 215–251（37 aa） Chain B 215–250（36 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；0.1M NaH2PO4 H2O,0.1M KH2PO4,2.0M NaCl,0.1M Mes H20 pH 6	Resolution 2.83 Å R-free 0.281
9CO5 Crystal Structure of Macrocycle mediated complex of FKBP12 and MAPRE1 Deposited 2024-07-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 193–252（60 aa）	Not recorded	A1AZI (5S,14R,16aS,21R,28S,30aR)-14-[2-(3,4-dimethoxyphenyl)ethyl]-24,24,28-trimethyl-2-methylidene-1,3,4,17,18,19,20,24,25,28,29,30a-dodecahydro-2H,14H-9,13-(metheno)dipyrido[1,2-d:1',2'-o][1,10,18,4,7,15]trioxatriazacyclotetracosine-6,16,22,23,27,30(7H,16aH)-hexone × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；1.5 M LiSO4, 0.1 M CH3COONa pH 4.6	Resolution 2.77 Å R-free 0.225
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain AC 190–255（66 aa） Chain CC 190–255（66 aa） Chain Cc 190–255（66 aa） Chain EC 190–255（66 aa） Chain Ec 190–255（66 aa） Chain GC 190–255（66 aa） Chain Gc 190–255（66 aa） Chain MC 190–255（66 aa） Chain Mc 190–255（66 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

31 other PDB entries and 48 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MARE1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–6； UniProt 262–267

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2hl3
Deposition date deposition_date	2006-07-06
Structure title title	Crystal structure of the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) in complex with human EB1 C-terminal hexapeptide
Keywords keywords	;microtubule binding, dynactin, cytoskeleton associated protein, p150Glued, EB1, +TIP protein Complex structure, EEY/F-COO- sequence motif, CLIP-170, alpha-tubulin, structural protein ;; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.79 Å
Radius of gyration Rg (electron density) rg_electron	18.13 Å
Forward intensity I(0) i0	5250930.00
Molecular weight molecular_weight	16588.0 kDa
Excluded volume excluded_volume	20768 Å³
Envelope volume envelope_volume	25186 Å³
Hydration-shell volume shell_volume	12468 Å³
Envelope diameter envelope_diameter	62.9 Å
Shell Rg shell_rg	22.67 Å
Envelope Rg envelope_rg	18.21 Å
Shape Rg shape_rg	18.09 Å
Total Rg total_rg	19.01 Å
Total atoms total_atoms	1169
Residues n_residues	151
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	65.3 Å
Rg (real space) rg_real	18.85 Å
Rg uncertainty (real space) rg_real_error	0.56 Å
I(0) (real space) i0_real	5.2510e+06
I(0) uncertainty (real space) i0_real_error	6.9280e+04
Rg (reciprocal space) rg_reciprocal	18.84 Å
I(0) (reciprocal space) i0_reciprocal	5251000.0000
Solution quality estimate total_estimate	0.8594
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	17.9 Å
Skewness Skewness skewness	0.361
Kurtosis Kurtosis kurtosis	-0.532
Angular range angular_range	— – 0.4250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1095000.0000
Real-space data points n_real_points	74
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.790; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.803; Smooth: 0.998

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Dynactin-1
Molecular weight formula_weight	10369.5 kDa
Mutation mutation	A49M
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1236

GSHMSAEASARPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Microtubule-associated protein RP/EB family member 1
Molecular weight formula_weight	825.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

EEQEEY

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	67

▼

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	2hl3A00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	190 — CAP Gly-rich-like domain

Domain ID domain_id	2hl3B00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	190 — CAP Gly-rich-like domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	43.062 Å
Unit-cell length b length_b	55.068 Å
Unit-cell length c length_c	66.221 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.030 Å
Low-resolution limit resolution_low	42.330 Å
R factor r_factor	0.1848
R_work r_work	0.1830
R_free r_free	0.2234

fit	/app/data/saxs_computation/hl/2hl3/2hl3.fit
pddf	/app/data/pr_computation/hl/2hl3/2hl3.pr.out
profile	/app/data/saxs_computation/hl/2hl3/2hl3.dat

Crystal structure of the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) in complex with human EB1 C-terminal hexapeptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dynactin-1

State in the Current Structure

Other States of the Same Protein in the Database

Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)