5tok

Crystal structure of the RSV F glycoprotein in complex with the neutralizing single-domain antibody F-VHH-L66

Method: X-RAY DIFFRACTION D_max: 145.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0, Fibritin chimera

Human respiratory syncytial virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–513 Chain B； UniProt 1–513 Chain C； UniProt 1–513	Mutation：S155C, S190F, V207L, S290C, I379V, M447V	Single-domain antibody F-VHH-L66 × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：LIQUID DIFFUSION；293 K；4.79 mg/mL EndoH-digested DS-Cav1 + F-VHH-L66, 0.05 M potassium phosphate, 20% w/v PEG4000	Resolution 3.80 Å R-free 0.286

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5TOK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
29QJ Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex with Double stapled peptide 4/4g Deposited 2026-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 159–209（51 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.32 Å R-free 0.232
3IXT Crystal Structure of Motavizumab Fab Bound to Peptide Epitope Deposited 2009-09-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 254–277（24 aa） Fragment：sequence database residues 254-277	Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；17.5% PEG 8000, 0.2 M zinc acetate, 0.1 M cacodylate pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.75 Å R-free 0.274
3IXT Crystal Structure of Motavizumab Fab Bound to Peptide Epitope Deposited 2009-09-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 254–277（24 aa） Fragment：sequence database residues 254-277	Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；17.5% PEG 8000, 0.2 M zinc acetate, 0.1 M cacodylate pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.75 Å R-free 0.274
3KPE Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed with TMC353121, a small-moleucule inhibitor of RSV Deposited 2009-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 159–209（51 aa） Fragment：proteinase K-resistant core of heptad repeat 1 Chain B 482–520（39 aa） Fragment：proteinase K-resistant core of heptad repeat 2	Not recorded	TM3 2-[[6-[[[2-(3-hydroxypropyl)-5-methylphenyl]amino]methyl]-2-[[3-(4-morpholinyl)propyl]amino]-1H-benzimidazol-1-yl]methyl]-6-methyl-3-pyridinol × 3 PG4 TETRAETHYLENE GLYCOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；30% (v/v) PEG-400 + 100 mM HEPES, pH 7.5 + 200 mM NaCl, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.47 Å R-free 0.196
3O41 Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope Deposited 2010-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 422–436（15 aa） Fragment：Residues 422-436	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20.5% (w/v) PEG 4000, 0.2 M lithium sulfate monohydrate, 0.1 M Tris-HCl pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.95 Å R-free 0.217
3O41 Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope Deposited 2010-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 422–436（15 aa） Fragment：Residues 422-436	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20.5% (w/v) PEG 4000, 0.2 M lithium sulfate monohydrate, 0.1 M Tris-HCl pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.95 Å R-free 0.217
3O45 Crystal Structure of 101F Fab Bound to 17-mer Peptide Epitope Deposited 2010-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 422–438（17 aa） Fragment：UNP residues 422-438	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20.5% (w/v) PEG 4000, 0.2 M lithium sulfate monohydrate, 0.1 M Tris-HCl pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.87 Å R-free 0.254
3O45 Crystal Structure of 101F Fab Bound to 17-mer Peptide Epitope Deposited 2010-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 422–438（17 aa） Fragment：UNP residues 422-438	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20.5% (w/v) PEG 4000, 0.2 M lithium sulfate monohydrate, 0.1 M Tris-HCl pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.87 Å R-free 0.254
3RKI Structural basis for immunization with post-fusion RSV F to elicit high neutralizing antibody titers Deposited 2011-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–524（524 aa） Fragment：Respiratory Syncytial Virus F, residues 1-524 Chain B 1–524（524 aa） Fragment：Respiratory Syncytial Virus F, residues 1-524 Chain C 1–524（524 aa） Fragment：Respiratory Syncytial Virus F, residues 1-524	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.1；298 K；4.2 M Sodium Formate, 100 mM Sodium Acetate, pH 5.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.264
4JHW Crystal Structure of Respiratory Syncytial Virus Fusion Glycoprotein Stabilized in the Prefusion Conformation by Human Antibody D25 Deposited 2013-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 26–109（84 aa） Chain F 137–513（377 aa）	Mutation：P102A, I379V, M447V Mutation：P102A, I379V, M447V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；30% (w/v) PEG 400, 3.75% (w/v) PEG 3350, 0.1 M HEPES pH 7.5, and 1% (v/v) 1,2-butanediol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.60 Å R-free 0.267
4MMQ Crystal Structure of Prefusion-stabilized RSV F Variant DS Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 26–107（82 aa） Chain B 137–513（377 aa）	Mutation：P102A Mutation：S155C, S290C, I379V, M447V	SO4 SULFATE ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；298 K；1.4 M K/Na tartrate, 0.1M CHES pH 9.5, 0.2 M LiSO4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.25 Å R-free 0.274
4MMR Crystal Structure of Prefusion-stabilized RSV F Variant Cav1 at pH 9.5 Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 26–107（82 aa） Chain B 137–513（377 aa）	Mutation：P102A Mutation：S190F, V207L, I379V, M447V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.4M sodium potassium tartarate, 0.1M CHES, pH 9.5, 0.2M Li2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.10 Å R-free 0.264
4MMS Crystal Structure of Prefusion-stabilized RSV F Variant Cav1 at pH 5.5 Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 26–107（82 aa） Chain B 137–513（377 aa） Chain C 26–107（82 aa） Chain D 137–513（377 aa） Chain E 26–107（82 aa） Chain F 137–513（377 aa）	Mutation：P102A Mutation：S190F, V207L, I379V, M447V Mutation：P102A Mutation：S190F, V207L, I379V, M447V Mutation：P102A Mutation：S190F, V207L, I379V, M447V	SO4 SULFATE ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；1.7 M ammonium sulfate, 0.1 M citrate pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.40 Å R-free 0.214
4MMT Crystal Structure of Prefusion-stabilized RSV F Variant DS-Cav1 at pH 9.5 Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 26–107（82 aa） Chain B 137–513（377 aa）	Mutation：P102A Mutation：S155C, S190F, V207L, S290C, I379V, M447V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；1.8 M Na/K tartrate, 0.2 M LiSO4, 0.1 M CHES pH9.5, VAPOR DIFFUSION, HANGING DROP	Resolution 3.05 Å R-free 0.243
4MMU Crystal Structure of Prefusion-stabilized RSV F Variant DS-Cav1 at pH 5.5 Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 26–107（82 aa） Chain B 137–513（377 aa）	Mutation：P102A Mutation：S155C, S190F, V207L, S290C, I379V, M447V	SO4 SULFATE ION × 12 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；1.8 M Ammonium sulphate 0.1 M citrate pH5.5, VAPOR DIFFUSION, HANGING DROP	Resolution 3.00 Å R-free 0.228
4MMV Crystal Structure of Prefusion-stabilized RSV F Variant DS-Cav1-TriC at pH 9.5 Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 26–107（82 aa） Chain B 137–513（377 aa）	Mutation：P102A Mutation：S155C, S190F, V207L, S290C, I379V, M447, VD486H, E487Q, F488W, D489H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.4M sodium potassium tartarate, 0.1M CHES, pH 9.5, 0.2M Li2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.81 Å R-free 0.279
4ZYP Crystal Structure of Motavizumab and Quaternary-Specific RSV-Neutralizing Human Antibody AM14 in Complex with Prefusion RSV F Glycoprotein Deposited 2015-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 26–513（488 aa） Chain B 26–513（488 aa） Chain C 26–513（488 aa）	Mutation：S155C, S190F, V207L, S290C, I379V, M447V Mutation：S155C, S190F, V207L, S290C, I379V, M447V Mutation：S155C, S190F, V207L, S290C, I379V, M447V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；5.645mg/mL EndoH digested DS-Cav1 + AM14 Fab + Motavizumab Fab, 11.4% PEG8000, 1.71% MPD, 0.1M Imidazole pH 6.5	Resolution 5.50 Å R-free 0.277
5C69 Crystal Structure of Prefusion-stabilized RSV F variant PR-DM Deposited 2015-06-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 26–518（493 aa） Fragment：F2 subunit, F1 subunit ectodomain	Mutation：N67I, S215P, I379V, M447V	SO4 SULFATE ION × 42 NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 12 CL CHLORIDE ION × 30	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 9.5；293 K；1.24M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.30 Å R-free 0.217
5C6B Crystal Structure of Prefusion-stabilized RSV F variant SC-TM Deposited 2015-06-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 6 PDB declaration: hexameric	Chain F 26–513（488 aa） Fragment：ectodomain	Mutation：N67I, S215P, E487Q, I379V, M447V,N67I, S215P, E487Q, I379V, M447V	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 6 SO4 SULFATE ION × 24 CL CHLORIDE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 9.5；293 K；1.34M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.40 Å R-free 0.211
5EA3 Crystal Structure of Inhibitor JNJ-2408068 in Complex with Prefusion RSV F Glycoprotein Deposited 2015-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa） Fragment：RSV F ectodomain (UNP residues 1-513)	Mutation：V207L, S190F, S155C, S290C	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 SO4 SULFATE ION × 18 5NK 2-[[2-[[1-(2-azanylethyl)piperidin-4-yl]amino]-4-methyl-benzimidazol-1-yl]methyl]-6-methyl-pyridin-3-ol × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 2.75 Å R-free 0.229
5EA4 Crystal Structure of Inhibitor JNJ-49153390 in Complex with Prefusion RSV F Glycoprotein Deposited 2015-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa） Fragment：RSV F ectodomain (UNP residues 1-513)	Mutation：S190F, V207L, S155C, S290C	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 SO4 SULFATE ION × 15 5NM 3-[[5-bromanyl-1-(3-methylsulfonylpropyl)benzimidazol-2-yl]methyl]-1-cyclopropyl-imidazo[4,5-c]pyridin-2-one × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 2.30 Å R-free 0.214
5EA5 Crystal Structure of Inhibitor TMC-353121 in Complex with Prefusion RSV F Glycoprotein Deposited 2015-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa） Fragment：RSV F ectodomain (UNP residues 1-513)	Mutation：S190F, V207L, S155C, S290C	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 TM3 2-[[6-[[[2-(3-hydroxypropyl)-5-methylphenyl]amino]methyl]-2-[[3-(4-morpholinyl)propyl]amino]-1H-benzimidazol-1-yl]methyl]-6-methyl-3-pyridinol × 3 SO4 SULFATE ION × 3 TAR D(-)-TARTARIC ACID × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 3.05 Å R-free 0.248
5EA6 Crystal Structure of Inhibitor BTA-9881 in Complex with Prefusion RSV F Glycoprotein Deposited 2015-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa） Fragment：RSV F ectodomain (UNP residues 1-513)	Mutation：S190F, V207L, S155C, S290C	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 SO4 SULFATE ION × 12 5NP (9~{b}~{R})-9~{b}-(4-chlorophenyl)-1-pyridin-3-ylcarbonyl-2,3-dihydroimidazo[5,6]pyrrolo[1,2-~{a}]pyridin-5-one × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 2.75 Å R-free 0.235
5EA7 Crystal Structure of Inhibitor BMS-433771 in Complex with Prefusion RSV F Glycoprotein Deposited 2015-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa） Fragment：RSV F ectodomain (UNP residues 1-513)	Mutation：S190F, V207L, S155C, S290C	SO4 SULFATE ION × 15 NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 5NO 1-cyclopropyl-3-[[1-(4-oxidanylbutyl)benzimidazol-2-yl]methyl]imidazo[4,5-c]pyridin-2-one × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 2.85 Å R-free 0.241
5EA8 Crystal Structure of Prefusion RSV F Glycoprotein Fusion Inhibitor Resistance Mutant D489Y Deposited 2015-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa） Fragment：RSV F ectodomain (UNP residues 1-513)	Mutation：S190F, V207L, S155C, S290C, D489Y	SO4 SULFATE ION × 15 NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 TAR D(-)-TARTARIC ACID × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 2.60 Å R-free 0.237
5J3D Crystal structure of human Fab 14N4 in complex with post-fusion RSV F Deposited 2016-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain E 26–98（73 aa） Fragment：UNP residues 26-98 Chain F 147–513（367 aa） Fragment：UNP residues 147-513 Chain G 26–98（73 aa） Fragment：UNP residues 26-98 Chain I 147–513（367 aa） Fragment：UNP residues 147-513 Chain J 26–98（73 aa） Fragment：UNP residues 26-98 Chain K 147–513（367 aa） Fragment：UNP residues 147-513	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；2 M ammonium sulfate, 5% 2-propanol	Resolution 4.08 Å R-free 0.282
5K6B Crystal structure of prefusion-stabilized RSV F single-chain 9 DS-Cav1 variant. Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 26–105（80 aa） Fragment：UNP residues 26-105 linked to residues 145-509 via LINKER residues GS Chain F 145–509（365 aa） Fragment：UNP residues 26-105 linked to residues 145-509 via LINKER residues GS	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 SO4 SULFATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.1 M NaOAc-Acetic Acid pH 5.5, 1.09 M Li2SO4, 0.12 M MgSO4, 3.33 % (w/v) PEG 400	Resolution 2.98 Å R-free 0.260
5K6C Crystal structure of prefusion-stabilized RSV F single-chain 9-10 DS-Cav1 variant. Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 26–103（78 aa） Fragment：UNP residues 26-101 linked to residues 145-509 via LINKER residues ATGS Chain F 145–509（365 aa） Fragment：UNP residues 26-101 linked to residues 145-509 via LINKER residues ATGS	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1 M HEPES pH 7.5, 0.19 M (NH4)2SO4, 11 % iso-propanol, 17 % PEG 8,000	Resolution 3.58 Å R-free 0.262
5K6F Crystal structure of prefusion-stabilized RSV F single-chain 9-19 DS-Cav1 variant. Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 26–103（78 aa） Fragment：UNP residues 26-103 linked to residues 145-509 via LINKER residues GGSGGSG Chain F 145–509（365 aa） Fragment：UNP residues 26-103 linked to residues 145-509 via LINKER residues GGSGGSG	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Na citrate pH 5.6, 15 % iso-propanol, 17 % PEG 4,000	Resolution 2.59 Å R-free 0.237
5K6G Crystal structure of prefusion-stabilized RSV F single-chain 9-24 DS-Cav1 variant. Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 26–96（71 aa） Fragment：UNP residues 26-79 and UNP residues 145-509 linked via LINKER residues GS Chain F 145–509（365 aa） Fragment：UNP residues 26-79 and UNP residues 145-509 linked via LINKER residues GS	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M NaOAc-Acetic Acid pH 5.5, 1.82 M Li2SO4, 0.1 M MgSO4, 5 % (w/v) PEG 400	Resolution 2.90 Å R-free 0.287
5K6H Crystal structure of prefusion-stabilized RSV F single-chain 9-10 DS-Cav1 A149C-Y458C variant. Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 26–103（78 aa） Fragment：UNP residues 26-103 linked to residues 145-509 via LINKER residues GS Chain F 145–509（365 aa） Fragment：UNP residues 26-103 linked to residues 145-509 via LINKER residues GS	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M phosphate-citrate, pH4.2, 0.12 M NaCl, 9.5% (w/v) PEG 8,000	Resolution 2.65 Å R-free 0.252
5K6I Crystal structure of prefusion-stabilized RSV F single-chain 9-10 DS-Cav1 A149C-Y458C, S46G-E92D-S215P-K465Q variant. Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 26–103（78 aa） Fragment：UNP residues 26-103 and residues 145-509 linked via LINKER residues GS Chain F 145–509（365 aa） Fragment：UNP residues 26-103 and residues 145-509 linked via LINKER residues GS	Not recorded	ZN ZINC ION × 6 EDO 1,2-ETHANEDIOL × 6 PO4 PHOSPHATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1M Na Cacodylate, pH 6.5, 0.2M ZnAC, 17% (w/v) PEG 8,000	Resolution 2.92 Å R-free 0.253
5TOJ Crystal structure of the RSV F glycoprotein in complex with the neutralizing single-domain antibody F-VHH-4 Deposited 2016-10-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–513（513 aa） Chain B 1–513（513 aa） Chain C 1–513（513 aa）	Mutation：S155C, S190F, V207L, S290C, I379V, M447V Mutation：S155C, S190F, V207L, S290C, I379V, M447V Mutation：S155C, S190F, V207L, S290C, I379V, M447V	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；2.45 mg/mL EndoH-digested DS-Cav1 + F-VHH-4, 14.75% w/v PEG3350, 8.8% v/v isopropanol, 0.2 M ammonium citrate	Resolution 3.30 Å R-free 0.234
5TPN Crystal structure of RSV F in complex with human antibody hRSV90 Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 27–513（487 aa）	Mutation：N67I, S215P, I379V, M447V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% PEG, 400/200 mM MgCl2, 6H2O/100 mM HEPES pH 7.5	Resolution 3.14 Å R-free 0.262
5U68 Structural basis for antibody cross-neutralization of respiratory syncytial virus and human metapneumovirus Deposited 2016-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–513（513 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28 Chain B 1–513（513 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28 Chain C 1–513（513 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；0.1M Potassium Nitrate, 0.1M Citrate Phosphate pH 4.2, 1 % Tacsimate pH 7.0, 14 (w/v) % PEG 6000	Resolution 3.08 Å R-free 0.239
5UDC Crystal Structure of RSV F A2 Bound to MEDI8897 Deposited 2016-12-26	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–513（513 aa） Chain D 1–513（513 aa） Chain F 1–513（513 aa）	Mutation：S155C, S290C, S190F, V207L Mutation：S155C, S290C, S190F, V207L Mutation：S155C, S290C, S190F, V207L	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；10% w/v PEG8000, 20% v/v ethylene glycol, 0.1 M Tris/BICINE pH 8.5, 0.02 M carboxylic acids, 0.3 M NDSB-195	Resolution 3.45 Å R-free 0.232
5W23 Crystal Structure of RSV F in complex with 5C4 Fab Deposited 2017-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–513（513 aa） Fragment：UNP residues 1-513 Chain B 1–513（513 aa） Fragment：UNP residues 1-513 Chain C 1–513（513 aa） Fragment：UNP residues 1-513	Not recorded	ZN ZINC ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Seed stock: 0.01 M zinc sulfate heptahydrate, 0.1 M MES hydrate pH 6.5, 22.5% v/v PEG MME 550 and 0.5% w/v polyvinylpyrrolidone K15 Reservoir solution: 0.2 M ammonium acetate, 0.1 M BIS-TRIS pH 6.5 and 25% PEG 3350	Resolution 3.40 Å R-free 0.239
6CXC 3.9A Cryo-EM structure of murine antibody bound at a novel epitope of respiratory syncytial virus fusion protein Deposited 2018-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 26–526（501 aa） Chain B 26–526（501 aa） Chain C 26–526（501 aa） Chain D 26–526（501 aa） Chain E 26–526（501 aa） Chain F 26–526（501 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
6DC3 RSV prefusion F bound to RSD5 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa）	Not recorded	SO4 SULFATE ION × 13 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.8 M Lithium sulfate, 0.1 M Tris pH 8.0	Resolution 3.50 Å R-free 0.205
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–513（513 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1–513（513 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–513（513 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6OE4 Prefusion RSV F monomer bound by neutralizing antibody CR9501 Deposited 2019-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–513（513 aa）	Mutation：S155C, S290C	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；4.2mg/mL monomeric prefusion F (DS-Cav1) + CR9501 Fab, 14.3% (w/v) PEG8000, 2.4% (v/v) 2-methyl-2,4-pentanediol (MPD), 0.1 M sodium citrate pH 5.5, 0.1 M sodium malonate pH 7.0	Resolution 3.30 Å R-free 0.259
6OE4 Prefusion RSV F monomer bound by neutralizing antibody CR9501 Deposited 2019-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1–513（513 aa）	Mutation：S155C, S290C	EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；4.2mg/mL monomeric prefusion F (DS-Cav1) + CR9501 Fab, 14.3% (w/v) PEG8000, 2.4% (v/v) 2-methyl-2,4-pentanediol (MPD), 0.1 M sodium citrate pH 5.5, 0.1 M sodium malonate pH 7.0	Resolution 3.30 Å R-free 0.259
6OE5 Splayed open prefusion RSV F captured by CR9501 and motavizumab Fabs Deposited 2019-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–513（513 aa）	Mutation：N67I, S215P	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；4.69 mg/mL prefusion F (PR-DM) + motavizumab Fab + CR9501 Fab, 30% (v/v) PEG400, 0.19 M ammonium sulfate, 3.1% (w/v) PEG8000, 0.1 M Tris pH 8.5	Resolution 4.10 Å R-free 0.306
6OUS Structure of fusion glycoprotein from human respiratory syncytial virus Deposited 2019-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 26–109（84 aa） Chain B 137–513（377 aa） Chain C 26–109（84 aa） Chain D 137–513（377 aa） Chain E 26–109（84 aa） Chain F 137–513（377 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM Tris 8.5, 10% PEG 8000, 200 mM ammonium sulfate	Resolution 3.40 Å R-free 0.275
6OUS Structure of fusion glycoprotein from human respiratory syncytial virus Deposited 2019-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 26–109（84 aa） Chain H 137–513（377 aa） Chain I 26–109（84 aa） Chain J 137–513（377 aa） Chain K 26–109（84 aa） Chain L 137–513（377 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM Tris 8.5, 10% PEG 8000, 200 mM ammonium sulfate	Resolution 3.40 Å R-free 0.275
6W52 Prefusion RSV F bound by neutralizing antibody RSB1 Deposited 2020-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 26–107（82 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M Hepes pH 7.5, 25% PEG 2000 MME, 0.01 M spermidine	Resolution 3.74 Å R-free 0.286
7MMN Crystal Structure of the Prefusion RSV F Glycoprotein bound by human antibody AM14 Deposited 2021-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 26–97（72 aa） Chain B 137–513（377 aa） Chain C 26–97（72 aa） Chain I 137–513（377 aa） Chain J 26–97（72 aa） Chain K 137–513（377 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.2M NaCl, 0.1M MES pH 6.0, 20% w/v PEG 2000 MME	Resolution 3.57 Å R-free 0.245
8KG5 Prefusion RSV F Bound to Lonafarnib and D25 Fab Deposited 2023-08-17	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–513（513 aa） Chain B 1–513（513 aa） Chain C 1–513（513 aa）	Not recorded	336 4-{2-[4-(3,10-DIBROMO-8-CHLORO-6,11-DIHYDRO-5H-BENZO[5,6]CYCLOHEPTA[1,2-B]PYRIDIN-11-YL)PIPERIDIN-1-YL]-2-OXOETHYL}PIPERIDINE-1-CARBOXAMIDE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8ULJ Prefusion RSV F bound by neutralizing antibody 2E08 Deposited 2023-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 26–104（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；23.64%w/v PEG 1500, 0.1 M MMT buffer (DL-malic acid:MES:Tris base at a molar ratio of 1:2:2) with pH 4.36	Resolution 3.00 Å R-free 0.264
8ULK Prefusion RSV F bound by neutralizing antibody 1G12 Deposited 2023-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 26–97（72 aa） Chain B 26–97（72 aa） Chain C 26–97（72 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.2 M Sodium sulfate, 20 % w/v PEG 3350	Resolution 4.28 Å R-free 0.279
9HVW Respiratory Syncytial Virus Fusion protein in the postfusion conformation in complex with monoclonal antibody 131-2a Fab Deposited 2025-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 26–105（80 aa） Chain B 26–105（80 aa） Chain C 26–105（80 aa） Chain D 137–515（379 aa） Chain E 137–515（379 aa） Chain F 137–515（379 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9LM5 Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 1G9 Deposited 2025-01-18	Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–513（513 aa） Chain B 1–513（513 aa） Chain C 1–513（513 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.77 Å
9LM6 Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 1D8 Deposited 2025-01-18	Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–513（513 aa） Chain B 1–513（513 aa） Chain C 1–513（513 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
9MKN Structure of the Respiratory Syncytial Virus Fusion Protein Bound to Human Antibodies RSV_2245 and RSV_3301 Deposited 2024-12-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 27–96（70 aa） Chain B 137–506（370 aa） Chain C 27–96（70 aa） Chain D 137–506（370 aa） Chain E 27–96（70 aa） Chain F 137–506（370 aa）	Mutation：I379V, M447V variant Mutation：I379V, M447V variant Mutation：I379V, M447V variant	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9RA5 Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex with Double stapled peptide 3/4i Deposited 2025-05-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 159–209（51 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.62 Å R-free 0.207
9U74 Respiratory Syncytial Virus pre-F trimer bound by neutralizing antibody PR306007 Deposited 2025-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 26–103（78 aa） Chain B 137–513（377 aa） Chain C 26–103（78 aa） Chain D 137–513（377 aa） Chain E 26–103（78 aa） Chain F 137–513（377 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.08 Å
9WDP Cyro-EM structure of prefusion RSV fusion glycoprotein in complex with Ziresovir and motavizumab Fab Deposited 2025-08-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–513（513 aa） Chain B 1–513（513 aa） Chain C 1–513（513 aa）	Not recorded	A1EV1 ~{N}-[(3-azanyloxetan-3-yl)methyl]-2-[1,1-bis(oxidanylidene)-3,5-dihydro-2~{H}-1$l^{6},4-benzothiazepin-4-yl]-6-methyl-quinazolin-4-amine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å

52 other PDB entries and 59 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FUS_HRSVA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–513； UniProt 1–513 Author chain B； PDBConstruct 1–513； UniProt 1–513 Author chain C； PDBConstruct 1–513； UniProt 1–513

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5tok
Deposition date deposition_date	2016-10-17
Structure title title	Crystal structure of the RSV F glycoprotein in complex with the neutralizing single-domain antibody F-VHH-L66
Keywords keywords	Fusion, nanobody, immunoglobulin fold, complex, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	39.81 Å
Radius of gyration Rg (electron density) rg_electron	39.66 Å
Forward intensity I(0) i0	594721000.00
Molecular weight molecular_weight	199580.0 kDa
Excluded volume excluded_volume	250350 Å³
Envelope volume envelope_volume	329230 Å³
Hydration-shell volume shell_volume	69562 Å³
Envelope diameter envelope_diameter	156.1 Å
Shell Rg shell_rg	44.95 Å
Envelope Rg envelope_rg	40.06 Å
Shape Rg shape_rg	39.69 Å
Total Rg total_rg	39.86 Å
Total atoms total_atoms	13999
Residues n_residues	1770
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	145.3 Å
Rg (real space) rg_real	39.86 Å
Rg uncertainty (real space) rg_real_error	1.52 Å
I(0) (real space) i0_real	5.9470e+08
I(0) uncertainty (real space) i0_real_error	1.1020e+07
Rg (reciprocal space) rg_reciprocal	39.83 Å
I(0) (reciprocal space) i0_reciprocal	594700000.0000
Solution quality estimate total_estimate	0.8253
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	50.8 Å
Skewness Skewness skewness	0.510
Kurtosis Kurtosis kurtosis	0.351
Angular range angular_range	— – 0.2000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	87970000.0000
Real-space data points n_real_points	41
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.603; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.989; Smooth: 0.927

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F0, Fibritin chimera
Molecular weight formula_weight	61045.0 kDa
Mutation mutation	S155C, S190F, V207L, S290C, I379V, M447V
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	13999

MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGGLVPR

来源 Source

来源生物 organism	Human respiratory syncytial virus
NCBI Class编号 ncbi_taxonomy_id	11250
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Single-domain antibody F-VHH-L66
Molecular weight formula_weight	14356.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

QVQLQESGGGLVQPGGSLRLSCAASGFTLDYYYIGWFRQAPGKEREGVSCISSSHGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCATVAVAHFRGCGVDGMDYWGKGTQVTVSSHHHHHH

来源 Source

来源生物 organism	Lama glama
通用名 common_name	llama
NCBI Class编号 ncbi_taxonomy_id	9844
宿主生物 host_organism	Komagataella pastoris GS115

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	5tokD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5tokE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5tokF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	138.890 Å
Unit-cell length b length_b	138.890 Å
Unit-cell length c length_c	221.902 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	50.376 Å
R factor r_factor	0.2494
R_work r_work	0.2475
R_free r_free	0.2858

fit	/app/data/saxs_computation/to/5tok/5tok.fit
pddf	/app/data/pr_computation/to/5tok/5tok.pr.out
profile	/app/data/saxs_computation/to/5tok/5tok.dat

Crystal structure of the RSV F glycoprotein in complex with the neutralizing single-domain antibody F-VHH-L66

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0, Fibritin chimera

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)