SAXSdb — 8ulk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

Human respiratory syncytial virus A2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 12	1G12 Fab heavy chain × 3 1G12 Fab light chain × 3 Fusion glycoprotein F0,Fibritin × 3 （A0A088S9A7,P10104）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FUS_HRSVA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–72； UniProt 26–97 Author chain B； PDBConstruct 1–72； UniProt 26–97 Author chain C； PDBConstruct 1–72； UniProt 26–97

Fusion glycoprotein F0,Fibritin

Respiratory syncytial virus A2

UniProt A0A088S9A7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 12	Fusion glycoprotein F2 × 3 （P03420） 1G12 Fab heavy chain × 3 1G12 Fab light chain × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A088S9A7_HRSV
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–377； UniProt 137–513 Author chain J； PDBConstruct 1–377； UniProt 137–513 Author chain K； PDBConstruct 1–377； UniProt 137–513

Fusion glycoprotein F0,Fibritin

Respiratory syncytial virus A2

UniProt P10104

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 12	Fusion glycoprotein F2 × 3 （P03420） 1G12 Fab heavy chain × 3 1G12 Fab light chain × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	WAC_BPT4
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 382–408； UniProt 458–484 Author chain J； PDBConstruct 382–408； UniProt 458–484 Author chain K； PDBConstruct 382–408； UniProt 458–484

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ulk
Deposition date deposition_date	2023-10-16
Last revision last_revision	2024-11-06
Structure title title	Prefusion RSV F bound by neutralizing antibody 1G12
Keywords keywords	RSV, antibody, neutralizing, pre-fusion, glycoprotein, antiviral, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ulk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ulk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ulk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.29 Å
Rg (electron density)	53.25 Å
Total Rg	53.05 Å
Atom count	20187
Residues	2631
Excluded volume	360410 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ulk__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F2
Molecular weight formula_weight	8173.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	20187

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLM

Source Source

Source organism organism	Human respiratory syncytial virus A2
NCBI taxonomy ID ncbi_taxonomy_id	11259
Host organism host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	1G12 Fab heavy chain
Molecular weight formula_weight	25313.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H,F

QVQLVQSGAEVKKSGASVQVSCKASGYPFGNYGITWVRQAPGQGLEWMGWISAYNGQTYYAEKFQGRVTMTTDTSTSTGYMELRSLRSDDTAVYFCARDVPVVAAVLRDYWGQGVTVSSSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGSENLYFQGSHHHHHH

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	1G12 Fab light chain
Molecular weight formula_weight	23316.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,L,G

VKGMTQSPLFLPVTLGQPASISCRSSQSLVHSDGNIYLSWFQQRPGQSPRRLIYKVFDRDSGVPDRFSGSGSGTDFTLKISRVEAEDVAHYYCMQATHWPGTFGGGTKLTVLRTVAAPSVFLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPSKAGVETTTPSKQSNNKYSLSSVLSLTPEQWKSHRSYSCQVTHEGSTVEKTFAPT

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Fusion glycoprotein F0,Fibritin
Molecular weight formula_weight	45609.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K

FLGFLLGVGSAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGGLVPR

Source Source

Source organism organism	Respiratory syncytial virus A2
NCBI taxonomy ID ncbi_taxonomy_id	1972429
Host organism host_organism	Cricetulus griseus

▶

Unit-cell length a length_a	143.982 Å
Unit-cell length b length_b	174.605 Å
Unit-cell length c length_c	226.286 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	4.280 Å
Low-resolution limit resolution_low	46.950 Å
R factor r_factor	0.2460
R_work r_work	0.2436
R_free r_free	0.2786

Prefusion RSV F bound by neutralizing antibody 1G12

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

State in the Current Structure

Other States of the Same Protein in the Database

Fusion glycoprotein F0,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Fusion glycoprotein F0,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ulk__assembly_1__model_1

8ulk__assembly_1__model_1 | I(q)

8ulk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Prefusion RSV F bound by neutralizing antibody 1G12

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion glycoprotein F0,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion glycoprotein F0,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ulk__assembly_1__model_1

8ulk__assembly_1__model_1 | I(q)

8ulk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)