7ml4

RNA polymerase II initially transcribing complex (ITC)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor IIF subunit alpha

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FA_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Q； PDBConstruct 1–735； UniProt 1–735

Transcription initiation factor IIF subunit beta

OrganismNot specified

UniProt A0A6A5PZ00

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PZ00_YEASX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain R； PDBConstruct 1–398； UniProt 1–400

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt A0A6A5PTI6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PTI6_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–221； UniProt 1–221

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt A0A6A5Q270

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q270_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

Transcription initiation factor IIB

OrganismNot specified

UniProt P29055

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2B_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–345； UniProt 1–345

DNA-directed RNA polymerase subunit

OrganismNot specified

UniProt A0A6A5Q1P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q1P2_YEASX
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–1733； UniProt 1–1733

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt A0A6A5Q4H2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q4H2_YEASX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B； PDBConstruct 1–1224； UniProt 1–1224

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt A0A6A5Q0Z3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q0Z3_YEASX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain C； PDBConstruct 1–318； UniProt 1–318

DNA-directed RNA polymerases I, II, and III subunit RPABC1

OrganismNot specified

UniProt A0A6A5Q456

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q456_YEASX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I,II,and III subunit RPABC2

OrganismNot specified

UniProt A0A6L0ZRI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L0ZRI7_YEASX
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt A0A6A5Q8C2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q8C2_YEASX
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt A0A7I9EWC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7I9EWC2_YEASX
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain I； PDBConstruct 1–122； UniProt 1–122

DNA-directed RNA polymerases II subunit RPABC5

OrganismNot specified

UniProt A0A6A5Q7Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q7Q6_YEASX
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerase II subunit RPB11

OrganismNot specified

UniProt A0A6A5Q7A1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q7A1_YEASX
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain K； PDBConstruct 1–120； UniProt 1–120

DNA-directed RNA polymerases II subunit RPABC4

OrganismNot specified

UniProt A0A6A5PY05

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PY05_YEASX
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

BJ4_G0050160.mRNA.1.CDS.1

OrganismNot specified

UniProt A0A7I9BTI9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7I9BTI9_YEASX
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 3； PDBConstruct 1–321； UniProt 1–321

General transcription and DNA repair factor IIH helicase subunit XPD

OrganismNot specified

UniProt A0A6A5Q1C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q1C1_YEASX
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 0； PDBConstruct 1–778； UniProt 1–778

General transcription and DNA repair factor IIH subunit TFB4

OrganismNot specified

UniProt A0A7I9C5C2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7I9C5C2_YEASX
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 4； PDBConstruct 1–338； UniProt 1–338

General transcription and DNA repair factor IIH

OrganismNot specified

UniProt A0A7I9FQL5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7I9FQL5_YEASX
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 6； PDBConstruct 1–461； UniProt 1–461

General transcription and DNA repair factor IIH helicase subunit XPB

OrganismNot specified

UniProt Q00578

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAD25_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 7； PDBConstruct 1–843； UniProt 1–843

General transcription and DNA repair factor IIH subunit TFB5

OrganismNot specified

UniProt Q3E7C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB5_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain 5； PDBConstruct 1–72； UniProt 1–72

RNA polymerase II transcription factor B subunit 2

OrganismNot specified

UniProt A0A6A5Q2X3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q2X3_YEASX
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 2； PDBConstruct 1–513； UniProt 1–513

Transcription initiation factor IIE subunit beta

OrganismNot specified

UniProt A0A6A5PS93

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PS93_YEASX
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain X； PDBConstruct 1–328； UniProt 1–328

Transcription initiation factor IIA large subunit

OrganismNot specified

UniProt A0A6A5Q2T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q2T8_YEASX
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain U； PDBConstruct 1–286； UniProt 1–286

Transcription initiation factor IIA subunit 2

OrganismNot specified

UniProt A0A6A5PRZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PRZ0_YEASX
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain V； PDBConstruct 1–122； UniProt 1–122

TATA-box-binding protein

OrganismNot specified

UniProt P13393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （A0A6A5PTU5） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_YEAST
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain O； PDBConstruct 1–240； UniProt 1–240

Transcription initiation factor IIE subunit alpha

OrganismNot specified

UniProt A0A6A5PTU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 28 DNA 2 RNA 1	Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （A0A6A5PZ00） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A6A5PTI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A6A5Q270） Transcription initiation factor IIB × 1 （P29055） DNA-directed RNA polymerase subunit × 1 （A0A6A5Q1P2） DNA-directed RNA polymerase subunit beta × 1 （A0A6A5Q4H2） DNA-directed RNA polymerase II subunit RPB3 × 1 （A0A6A5Q0Z3） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （A0A6A5Q456） DNA-directed RNA polymerases I,II,and III subunit RPABC2 × 1 （A0A6L0ZRI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A6A5Q8C2） DNA-directed RNA polymerase II subunit RPB9 × 1 （A0A7I9EWC2） DNA-directed RNA polymerases II subunit RPABC5 × 1 （A0A6A5Q7Q6） DNA-directed RNA polymerase II subunit RPB11 × 1 （A0A6A5Q7A1） DNA-directed RNA polymerases II subunit RPABC4 × 1 （A0A6A5PY05） BJ4_G0050160.mRNA.1.CDS.1 × 1 （A0A7I9BTI9） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （A0A6A5Q1C1） General transcription and DNA repair factor IIH subunit TFB4 × 1 （A0A7I9C5C2） General transcription and DNA repair factor IIH × 1 （A0A7I9FQL5） Tfb1 × 1 General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） RNA polymerase II transcription factor B subunit 2 × 1 （A0A6A5Q2X3） Transcription initiation factor IIE subunit beta × 1 （A0A6A5PS93） Transcription initiation factor IIA large subunit × 1 （A0A6A5Q2T8） Transcription initiation factor IIA subunit 2 × 1 （A0A6A5PRZ0） non-template strand DNA × 1 template strand DNA × 1 TATA-box-binding protein × 1 （P13393） RNA × 1 ZINC ION × 15 MAGNESIUM ION × 1 IRON/SULFUR CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PTU5_YEASX
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain W； PDBConstruct 1–482； UniProt 1–482

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ml4
Deposition date deposition_date	2021-04-27
Structure title title	RNA polymerase II initially transcribing complex (ITC)
Keywords keywords	PIC, TFIIH, transcription, ITC, RNA polymerase II; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ml4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ml4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ml4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	83.25 Å
Rg (electron density)	83.55 Å
Total Rg	83.28 Å
Atom count	62733
Residues	8119
Excluded volume	1108100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ml4__assembly_1__model_1`	31-meric （31）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (34)

Entity 1 Entity 1 polymer

Description description	Transcription initiation factor IIF subunit alpha
Molecular weight formula_weight	82320.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q
Atom count atom_count	62733

MSRRNPPGSRNGGGPTNASPFIKRDRMRRNFLRMRMGQNGSNSSSPGVPNGDNSRGSLVKKDDPEYAEEREKMLLQIGVEADAGRSNVKVKDEDPNEYNEFPLRAIPKEDLENMRTHLLKFQSKKKINPVTDFHLPVRLHRKDTRNLQFQLTRAEIVQRQKEISEYKKKAEQERSTPNSGGMNKSGTVSLNNTVKDGSQTPTVDSVTKDNTANGVNSSIPTVTGSSVPPASPTTVSAVESNGLSNGSTSAANGLDGNASTANLANGRPLVTKLEDAGPAEDPTKVGMVKYDGKEVTNEPEFEEGTMDPLADVAPDGGGRAKRGNLRRKTRQLKVLDENAKKLRFEEFYPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATLTIDEAEKRMDKKSGEVPRWLMKHLDNIGTTTTRYDRTRRKLKAVADQQAMDEDDRDDNSEVELDYDEEFADDEEAPIIDGNEQENKESEQRIKKEMLQANAMGLRDEEAPSENEEDELFGEKKIDEDGERIKKALQKTELAALYSSDENEINPYLSESDIENKENESPVKKEEDSDTLSKSKRSSPKKQQKKATNAHVHKEPTLRVKSIKNCVIILKGDKKILKSFPEGEWNPQTTKAVDSSNNASNTVPSPIKQEEGLNSTVAEREETPAPTITEKDIIEAIGDGKVNIKEFGKFIRRKYPGAENKKLMFAIVKKLCRKVGNDHMELKKE

Entity 2 Entity 2 polymer

Description description	Transcription initiation factor IIF subunit beta
Molecular weight formula_weight	46512.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MSSGSAGAPALSNNSTNSVAKEKSGNISGDEYLSQEEEVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKSKITLLLNENDNDSIPHEYDLELTKKVVENEYVFTEQNLKKYQQRKKELEADPEKQRQAYLKKQEREEELKKKQQQQKRRNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQRRNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTLRPEYKKLKEEERKATLGELADEQTGSAGDNAQGDAEADLEDEIEMEDVV

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	25451.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19081.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI

Entity 5 Entity 5 polymer

Description description	Transcription initiation factor IIB
Molecular weight formula_weight	38257.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	191821.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	138937.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	35330.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	25117.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I,II,and III subunit RPABC2
Molecular weight formula_weight	17931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16525.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14308.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS

Entity 13 Entity 13 polymer

Description description	DNA-directed RNA polymerases II subunit RPABC5
Molecular weight formula_weight	8290.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Entity 14 Entity 14 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11
Molecular weight formula_weight	13633.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Entity 15 Entity 15 polymer

Description description	DNA-directed RNA polymerases II subunit RPABC4
Molecular weight formula_weight	7730.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Entity 16 Entity 16 polymer

Description description	BJ4_G0050160.mRNA.1.CDS.1
Molecular weight formula_weight	38188.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MLMDEYEENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIMNNLERSRTEIESFEQRQKFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVNRLSTTTQDINETIEGVKNTVKLKKSSARRKLEELNRVLKNNPYFNSNVNVQNSRLKDAVPFTPFNGDREAHPRFTLKGSVYNDPFIKDLEHRKEFIASGFNTNYAYERVLTEAFMGLGCVISEEL

Entity 17 Entity 17 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPD
Molecular weight formula_weight	89899.0 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MKFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTVSLLSLTIAYQMHYPEHRKIIYCSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQAKRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMISLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSLDLTTDALRRATRGANALDERISEVRKVDSQKLQDEYEKLVQGLHSADILTDQEEPFVETPVLPQDLLTEAIPGNIRRAEHFVSFLKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLEVTEVEDFTALKDIATFATLISTYEEGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVFERFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSFLPMIITKGSDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRFSRKRSQLPKWIAQGLSDADLNLSTDMAISNTKQFLRTMAQPTDPKDQEGVSVWSYEDLIKHQNSRKDQGGFIENENKEGEQDEDEDEDIEMQ

Entity 18 Entity 18 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB4
Molecular weight formula_weight	37430.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSXXYRRFRNVDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIPPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKKKVTKP

Entity 19 Entity 19 polymer

Description description	General transcription and DNA repair factor IIH
Molecular weight formula_weight	52024.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAPVVISESEEDEDRVAITRRTKRQVHFDGEGDDRVDQQQQQHSSSHRDRDKHVQRKKKKRLSNRNLQGSNGGYAWEDEIKRSWDLVKVDDEGDMASLVASIVEARKKRTAKKNITPYQRGIIRSLILTLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLKELFNEAVTPLPVNKINKGFTLVKMGFPTRIFEDTPTFCSCHSKLVYGGYFCPNCHSKVCSLPTVCPCCDLMLILSTHLARSYHHLMPLKTFAEVPTTEKFRSEDCFSCQSRFPXXXXXXXXXXXXXSRYRCEDCKQEFCVDCDVFIHEILHNCPGCESKPVIT

Entity 20 Entity 20 polymer

Description description	Tfb1
Molecular weight formula_weight	58722.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADIYEEKRRREESAQHTETPMSSSSVTAGTPTPHLDTPQLNNGAPLINTAKLDDSLSKEKLLTNLKLQQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRXFALXXSQKXGPXXVXXXXXPXXXXXXXXXXNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLXXXXXXXXXXXXXXXXXXLXXXXXFXXKXXXXLLHPVKKIIXLDGNIXDDPVVRGXXXXXXXXVDILKGMNRLSEKMIMXLKXXXKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVITXIKINAKQAXHXXXEVKSTLPIDLLESCRMLHTTCCEFLKHFAIHXXXXXQKQASTVKKLYNHLKDCIEKLNELFQDVLNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN

Entity 21 Entity 21 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPB
Molecular weight formula_weight	95461.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MTDVEGYQPKSKGKIFPDMGESFFSSDEDSPATDAEIDENYDDNRETSEGRGERDTGAMVTGLKKPRKKTKSSRHTAADSSMNQMDAKDKALLQDTNSDIPADFVPDSVSGMFRSHDFSYLRLRPDHASRPLWISPSDGRIILESFSPLAEQAQDFLVTIAEPISRPSHIHEYKITAYSLYAAVSVGLETDDIISVLDRLSKVPVAESIINFIKGATISYGKVKLVIKHNRYFVETTQADILQMLLNDSVIGPLRIDSDHQVQPPEDVLQQQLQQTAGKPATNVNPNDVEAVFSAVIGGDNEREEEDDDIDAVHSFEIANESVEVVKKRCQEIDYPVLEEYDFRNDHRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQWRQQFLQWCTLQPENCAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLTGREWGFIILDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKIGDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEAAGIEVGDDADNSVGRGSNGHKRFKSKAVRGEGSLSGLAGGEDMAYMEYSTNKNKELKEHHPLIRKMYYKNLKK

Entity 22 Entity 22 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB5
Molecular weight formula_weight	8243.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYNPMDEEENQ

Entity 23 Entity 23 polymer

Description description	RNA polymerase II transcription factor B subunit 2
Molecular weight formula_weight	58602.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLLDLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINLNPTFKISLRNALTGGEVQNSFGVVVEENVVSLDLLDEYSANKWETILHFMVGTPLAKIPSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLLQEINSQLWTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIMLQDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNREEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKLKKKQ

Entity 24 Entity 24 polymer

Description description	Transcription initiation factor IIE subunit beta
Molecular weight formula_weight	37050.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSKNRDPLLANLNAFKSKVKSAPVIAPAKVGQKKTNDTVITIDGNTRKRTASERAQENTLNSAKNPVLVDIKKEAGSNSSNAISLDDDDDDEDFGSSPSKKVRPGSIAAAALQANQTDISKSHDSSKLLWATEYIQKKGKPVLVNELLDYLSMKKDDKVIELLKKLDRIEFDPKKGTFKYLSTYDVHSPSELLKLLRSQVTFKGISCKDLKDGWPQCDETINQLEEDSKILVLRTKKDKTPRYVWYNSGGNLKCIDEEFVKMWENVQLPQFAELPRKLQDLGLKPASVDPATIKRQTKRVEVKKKRQRKGKITNTHMTGILKDYSHRV

Entity 25 Entity 25 polymer

Description description	Transcription initiation factor IIA large subunit
Molecular weight formula_weight	32230.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNEGNINGVQNDLNFNLATPGVNSSEFNIKEENTGNEGLILPNINSNNNIPHSGETNINTNTVEATNNSGATLNTNTSGNTNADVTSQPKIEVKPEIELTINNANITTVENIDDESEKKDDEEKEEDVEKTRKEKEQIEQVKLQAKKEKRSALLDTDEVGSELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV

Entity 26 Entity 26 polymer

Description description	Transcription initiation factor IIA subunit 2
Molecular weight formula_weight	13473.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE

Entity 27 Entity 27 polymer

Description description	non-template strand DNA
Molecular weight formula_weight	11825.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

AAAAAAAAAAGGCGCGTATATAAAAGCTATGGAACGTT

Entity 28 Entity 28 polymer

Description description	template strand DNA
Molecular weight formula_weight	34207.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

GATCCTCTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACGTTCCATAGCTTTTATATACGCGCCTTTTTTTTTT

Entity 29 Entity 29 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	27042.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Entity 30 Entity 30 polymer

Description description	Transcription initiation factor IIE subunit alpha
Molecular weight formula_weight	54804.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MDRPIDDIVKNLLKFVVRGFYGGSFVLVLDAILFHSVLAEDDLKQLLSINKTELGPLIARLRSDRLISIHKQREYPPNSKSVERVYYYVKYPHAIDAIKWKVHQVVQRLKDDLDKNSEPNGYMCPICLTKYTQLEAVQLLNFDRTEFLCSLCDEPLVEDDSGKKNKEKQDKLNRLMDQIQPIIDSLKKIDDSRIEENTFEIALARLIPPQNQSHAAYTYNPKKGSTMFRPGDSAPLPNLMGTALGNDSSRRAGANSQATLHINITTASDEVAQRELQERQAEEKRKQNAVPEWHKQSTIGKTALGRLDNEEEFDPVVTASAMDSINPDNEPAQETSYQNNRTLTEQEMEERENEKTLNDYYAALAKKQAKLNKEEEEEEEEEEDEEEEEEEEMEDVMDDNDETARENALEDEFEDVTDTAGTAKTESNTSNDVKQESINDKTEDAVNATATASGPSANAKPNDGDDDDDDDDDEMDIEFEDV

Entity 31 Entity 31 polymer

Description description	RNA
Molecular weight formula_weight	1649.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P

GAGGA

Entity 32 Entity 32 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 34 Entity 34 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

Domain ID domain_id	7ml4001
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	7ml4A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	274 — Enzyme I; Chain A, domain 2
Homologous superfamily homologous superfamily	100 — RNA polymerase Rpb1, domain 3

Domain ID domain_id	7ml4A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	140 —

Domain ID domain_id	7ml4B01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	7ml4K01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	254448

RNA polymerase II initially transcribing complex (ITC)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor IIF subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor IIF subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor IIB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I,II,and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer