8p9c

Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 F11

Method: X-RAY DIFFRACTION D_max: 71.3 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein 63

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 397–455	Not recorded	Tumor protein p73 × 2 （O15350） Darpin 1810 F11 × 2 EDO 1,2-ETHANEDIOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；0.2M ammonium acetate, 25% PEG3350, 0.1M HEPES pH 7.5	Resolution 1.76 Å R-free 0.210

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8P9C	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1RG6 Solution structure of the C-terminal domain of p63 Deposited 2003-11-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 501–575（75 aa） Fragment：C-terminal domain (residues 501-575)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 150mM NaCl；Pressure ambient NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 150mM NaCl；Pressure ambient NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 150mM NaCl；Pressure ambient NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 150mM NaCl；Pressure ambient NMR sample composition 0.75mM p63 U-15N, 25mM sodium posphate, 150mM sodium chloride, 1mM AEBSF, 3mM DTT, 95% H20, 5%D2O \| 95% H20, 5%D2O NMR sample composition 0.25mM p63 U-15N U-13C, 25mM sodium posphate, 150mM sodium chloride, 1mM AEBSF, 3mM DTT, 95% H20, 5%D2O \| 95% H20, 5%D2O NMR sample composition 0.25mM p63 U-15N U-13C, 25mM sodium posphate, 150mM sodium chloride, 1mM AEBSF, 3mM DTT, 100% D2O \| 100% D2O NMR sample composition 0.75mM p63 U-15N, 25mM sodium posphate, 150mM sodium chloride, 1mM AEBSF, 3mM DTT, phage \| phage	Resolution not provided
2NB1 P63/p73 hetero-tetramerisation domain Deposited 2016-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 397–455（59 aa） Fragment：Tetramerization domain of 63, UNP residues 397-455 Chain C 397–455（59 aa） Fragment：Tetramerization domain of 63, UNP residues 397-455	Mutation：K21E Mutation：K21E	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；310 K；Ionic strength (raw mmCIF value) 75；Pressure ambient NMR measurement conditions pH 6；310 K；Ionic strength (raw mmCIF value) 5；Pressure ambient NMR sample composition 0.5 mM [U-100% 13C; U-100% 15N] p63 tetramerization domain, 0.5 mM p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.5 mM p63 tetramerization domain, 0.5 mM [U-100% 13C; U-100% 15N] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.5 mM [U-100% 15N] p63 tetramerization domain, 0.5 mM [U-100% 13C] p63 tetramerization domain, 1 mM p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1 mM p63 tetramerization domain, 0.5 mM [U-100% 15N] p73 tetramerization domain, 0.5 mM [U-100% 13C] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.5 mM [U-100% 15N] p63 tetramerization domain, 0.5 mM p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 100% D2O \| 100% D2O NMR sample composition 0.5 mM p63 tetramerization domain, 0.5 mM [U-100% 15N] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 100% D2O \| 100% D2O NMR sample composition 0.5 mM [U-100% 15N] p63 tetramerization domain, 0.5 mM [U-100% 13C] p63 tetramerization domain, 0.5 mM [U-100% 15N] p73 tetramerization domain, 0.5 mM [U-100% 13C] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
2RMN The solution structure of the p63 DNA-binding domain Deposited 2007-11-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 153–384（232 aa） Fragment：DNA binding domain, UNP residues 153-384	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 6.8；303 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 0.7mM [U-15N] p63BDB; 50mM potassium chloride; 50mM potassium phosphate; 5mM DTT; 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 0.7mM [U-13C; U-15N] p63BDB; 50mM potassium chloride; 50mM potassium phosphate; 5mM DTT; 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2Y9T Structural basis of p63a SAM domain mutants involved in AEC syndrome Deposited 2011-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 543–622（80 aa） Fragment：SAM DOMAIN, RESIDUES 543-622	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 150 NMR sample composition 90% WATER/10% D2O	Resolution not provided
2Y9U Structural basis of p63a SAM domain mutants involved in AEC syndrome Deposited 2011-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 545–611（67 aa） Fragment：SAM DOMAIN, RESIDUES 545-611	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；100 MM SODIUM CITRATE, PH 6.4, 500MM LITHIUM SULPHATE, 500MM AMMONIUM SULPHATE, 5MM DTT	Resolution 1.60 Å R-free 0.206
3QYM Structure of p63 DNA Binding Domain in Complex with a 10 Base Pair A/T Rich Response Element Half Site Deposited 2011-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain B 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain C 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain D 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；10% PEG3350, 0.2 M ammonium formate, 0.1 M Bis-Tris, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.271
3QYM Structure of p63 DNA Binding Domain in Complex with a 10 Base Pair A/T Rich Response Element Half Site Deposited 2011-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain E 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain F 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain G 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain H 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；10% PEG3350, 0.2 M ammonium formate, 0.1 M Bis-Tris, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.271
3QYM Structure of p63 DNA Binding Domain in Complex with a 10 Base Pair A/T Rich Response Element Half Site Deposited 2011-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain C 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain D 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain E 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain F 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；10% PEG3350, 0.2 M ammonium formate, 0.1 M Bis-Tris, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.271
3QYN Structure of p63 DNA Binding Domain in Complex with a 22 Base Pair A/T Rich Response Element Containing 2 Base Pair Spacer Between Half Sites Deposited 2011-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain B 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain C 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain D 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；20% PEG3350, 0.2 M ammonium acetate, 0.1 M Bis-Tris, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.50 Å R-free 0.245
3US0 Structure of p63 DNA Binding Domain in Complex with a 22 Base Pair A/T Rich Response Element Containing a Two Base Pair "AT" Spacer Between Half Sites Deposited 2011-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain B 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain C 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain D 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；14% PEG3350, 0.2 M ammonium acetate, 0.1 M Bis-Tris, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.50 Å R-free 0.239
3US1 Structure of p63 DNA Binding Domain in Complex with a 22 Base Pair Response Element Containing a Two Base Pair "GC" Spacer Between Half Sites Deposited 2011-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain D 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；0.2 M ammonium phosphate monobasic, 0.1 M Bis-Tris, pH 6.8, 14% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.234
3US2 Structure of p63 DNA Binding Domain in Complex with a 19 Base Pair A/T Rich Response Element Containing Two Half Sites with a Single Base Pair Overlap Deposited 2011-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain B 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain C 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain D 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；0.2 M ammonium formate, 0.1 M Bis-Tris, pH 6.8, 12% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.20 Å R-free 0.334
3US2 Structure of p63 DNA Binding Domain in Complex with a 19 Base Pair A/T Rich Response Element Containing Two Half Sites with a Single Base Pair Overlap Deposited 2011-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain G 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain H 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain I 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362) Chain J 166–362（197 aa） Fragment：DNA binding domain (UNP residues 166-362)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；0.2 M ammonium formate, 0.1 M Bis-Tris, pH 6.8, 12% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.20 Å R-free 0.334
3ZY0 Crystal structure of a truncated variant of the human p63 tetramerization domain lacking the C-terminal helix Deposited 2011-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 304–333（30 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 304-333 Chain B 304–333（30 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 304-333 Chain C 304–333（30 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 304-333 Chain D 304–333（30 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 304-333	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 12-15 MG/ML IN 20 MM TRIS PH 8.5, 50 MM NACL CRYSTALLIZATION BUFFER: 30% PEG 400, 0.1 M HEPES PH 7.5, 0.2 M MG CHLORIDE.	Resolution 1.90 Å R-free 0.252
3ZY1 Crystal structure of the human p63 tetramerization domain Deposited 2011-08-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 398–441（44 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 398-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 12-15 MG/ML IN 20 MM TRIS PH 8.5, 50 MM NACL CRYSTALLIZATION BUFFER: 10% PEG 8000, 0.1 M HEPES PH 7.5, AND 0.2 M CA ACETATE	Resolution 2.15 Å R-free 0.285
4A9Z CRYSTAL STRUCTURE OF HUMAN P63 TETRAMERIZATION DOMAIN Deposited 2011-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 397–455（59 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 397-455 Chain B 397–455（59 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 397-455 Chain C 397–455（59 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 397-455 Chain D 397–455（59 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 397-455	Not recorded	PE4 2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.29 Å R-free 0.246
6FGN Solution Structure of p300Taz2-p63TA Deposited 2018-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–73（27 aa） Fragment：Taz2,transactivation domain	Not recorded	ZN ZINC ION × 3	SOLUTION NMR NMR measurement conditions pH 6.3；303 K；Ionic strength (raw mmCIF value) 200；Pressure AMBIENT NMR sample composition 1200 mM [U-13C; U-15N] Fusion construct of p300 Taz2 and the transactivation domain of p63, 25 mM MES, 200 mM NaCl, 0.5 mM TCEP, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6RU6 Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63 PAD1P peptide Deposited 2019-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 618–630（13 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 1 NA SODIUM ION × 1 EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；10-20% PEG 3350, 0.1-0.2 M sodium sulfate and 0.1 M citrate, pH 4.6-5.9	Resolution 2.05 Å R-free 0.257
6RU7 Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated p63 PAD2P peptide Deposited 2019-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 618–633（16 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EDO 1,2-ETHANEDIOL × 10 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；10-20% PEG 3350, 0.1-0.2 M sodium sulfate and 0.1 M citrate, pH 4.6-5.9	Resolution 2.08 Å R-free 0.218
6RU7 Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated p63 PAD2P peptide Deposited 2019-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 618–633（16 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；10-20% PEG 3350, 0.1-0.2 M sodium sulfate and 0.1 M citrate, pH 4.6-5.9	Resolution 2.08 Å R-free 0.218
6RU8 Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated p63 PAD3P peptide Deposited 2019-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 621–632（12 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EDO 1,2-ETHANEDIOL × 5 NA SODIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；10-20% PEG 3350, 0.1-0.2 M sodium sulfate and 0.1 M citrate, pH 4.6-5.9	Resolution 1.92 Å R-free 0.211
6RU8 Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated p63 PAD3P peptide Deposited 2019-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 621–632（12 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EDO 1,2-ETHANEDIOL × 4 NA SODIUM ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；10-20% PEG 3350, 0.1-0.2 M sodium sulfate and 0.1 M citrate, pH 4.6-5.9	Resolution 1.92 Å R-free 0.211
6RU8 Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated p63 PAD3P peptide Deposited 2019-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 621–632（12 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；10-20% PEG 3350, 0.1-0.2 M sodium sulfate and 0.1 M citrate, pH 4.6-5.9	Resolution 1.92 Å R-free 0.211
6RU8 Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated p63 PAD3P peptide Deposited 2019-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 621–632（12 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；10-20% PEG 3350, 0.1-0.2 M sodium sulfate and 0.1 M citrate, pH 4.6-5.9	Resolution 1.92 Å R-free 0.211
7Z71 Crystal structure of p63 DBD in complex with darpin C14 Deposited 2022-03-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 68–269（202 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；25% PEG 3350, 0.2 M sodium chloride, 0.1 M HEPES pH 7.5	Resolution 1.85 Å R-free 0.181
7Z71 Crystal structure of p63 DBD in complex with darpin C14 Deposited 2022-03-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 68–269（202 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；25% PEG 3350, 0.2 M sodium chloride, 0.1 M HEPES pH 7.5	Resolution 1.85 Å R-free 0.181
7Z72 Crystal structure of p63 SAM in complex with darpin A5 Deposited 2022-03-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 460–526（67 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 3.5；293.15 K；25% PEG3350, 0.1 M citrate pH 3.5	Resolution 1.80 Å R-free 0.188
7Z73 Crystal structure of p63 tetramerization domain in complex with darpin 8F1 Deposited 2022-03-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 303–361（59 aa） Chain B 303–361（59 aa） Chain C 303–361（59 aa） Chain D 303–361（59 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293.15 K；25% PEG3350, 0.2 M sodium chloride, 0.1 M bis-tris pH 5.5	Resolution 2.27 Å R-free 0.235
7Z7E Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4 Deposited 2022-03-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 68–269（202 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；295 K；25% PEG 3350 0.2M Li2SO4 0.1M HEPES	Resolution 1.80 Å R-free 0.249
8P9D Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 A2 Deposited 2023-06-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 397–455（59 aa） Chain C 397–455（59 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293.15 K；20% PEG3350, 0.1M bis-tris propane pH 7.0, 0.2M salicylic, sodium salt	Resolution 2.70 Å R-free 0.252
8P9E Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 F11 Deposited 2023-06-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: trimeric	Chain A 303–361（59 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293.15 K；0.2M sodium chloride, 25% PEG3350, 0.1M bis-tris pH 6.5	Resolution 2.25 Å R-free 0.250
9GFO iASPP-CTD fusion to p63 peptide Deposited 2024-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 373–381（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M sodium formate and 0.1 M TRIS pH 7.5	Resolution 2.40 Å R-free 0.280
9GFO iASPP-CTD fusion to p63 peptide Deposited 2024-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain BBB 373–381（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M sodium formate and 0.1 M TRIS pH 7.5	Resolution 2.40 Å R-free 0.280
9GFO iASPP-CTD fusion to p63 peptide Deposited 2024-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain CCC 373–381（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M sodium formate and 0.1 M TRIS pH 7.5	Resolution 2.40 Å R-free 0.280
9GFO iASPP-CTD fusion to p63 peptide Deposited 2024-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain DDD 373–381（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2 M sodium formate and 0.1 M TRIS pH 7.5	Resolution 2.40 Å R-free 0.280
9N54 Bipartite p63 NLS in complex with Importin Alpha 2 Deposited 2025-02-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 278–302（25 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；296 K；0.65 M sodium citrate, 0.1 M HEPES and 10 mM DTT	Resolution 2.20 Å R-free 0.206

25 other PDB entries and 36 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	P63_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–61； UniProt 397–455

Tumor protein p73

Homo sapiens

UniProt O15350

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain B； UniProt 351–398	Not recorded	Tumor protein 63 × 2 （Q9H3D4） Darpin 1810 F11 × 2 EDO 1,2-ETHANEDIOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；0.2M ammonium acetate, 25% PEG3350, 0.1M HEPES pH 7.5	Resolution 1.76 Å R-free 0.210

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P9C	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1COK STRUCTURE OF THE C-TERMINAL DOMAIN OF P73 Deposited 1999-05-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 439–506（68 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 150mM NACL, 25mM SODIUM PHOSPHATE NMR sample composition 10% WATER/90% D2O	Resolution not provided
1DXS Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha splice variant Deposited 2000-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 487–564（78 aa） Fragment：C-TERMINAL STERILE ALPHA MOTIF (SAM) DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；290 K；CRYSTALLIZED IN 0.1M TRIS-HCL PH8.5, 2.0M MONO-AMMONIUM DIHYDROGEN PHOSPHATE, AT 290K., pH 8.50	Resolution 2.54 Å R-free 0.346
2KBY The Tetramerization Domain of Human p73 Deposited 2008-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain B 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain C 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain D 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；303 K；Pressure 1 NMR measurement conditions 303 K；Pressure 1 NMR measurement conditions pH 6.8；303 K；Pressure 1 NMR sample composition 2.5mM [U-13C; U-15N] p73 TD-1, 20mM sodium phosphate-2, 100mM sodium chloride-3, 100% D2O \| 100% D2O NMR sample composition 2.5mM [U-13C; U-15N] p73 TD-4, 20mM sodium phosphate-5, 100mM sodium chloride-6, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 2.5mM [U-15N] p73 TD-7, 20mM sodium phosphate-8, 100mM sodium chloride-9, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 2.5mM [U-15N] p73 TD-10, 2.5mM [U-13C] p73 TD-11, 20mM sodium phosphate-12, 100mM sodium chloride-13, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 2.5mM [U-15N] p73 TD-14, 2.5mM [U-13C] p73 TD-15, 20mM sodium phosphate-16, 100mM sodium chloride-17, 100% D2O \| 100% D2O NMR sample composition 2.5mM [U-10% 13C] p73 TD-18, 20mM sodium phosphate-19, 100mM sodium chloride-20, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 2.5mM [U-13C; U-15N] p73 TD-21, 16.4 Hz Pf1 phage-22, 50mM arginine-23, 50mM glutamate-24, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
2MPS Structure of complex of MDM2(3-109) and P73 TAD(10-25) Deposited 2014-06-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 10–25（16 aa） Fragment：UNP residues 10-25	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；283 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 0.9 mM [U-99% 13C; U-99% 15N] E3 Ubiquitin-protein Ligase MDM2-1, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.9 mM [U-99% 13C; U-99% 15N] Tumor protein P73-2, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2NB1 P63/p73 hetero-tetramerisation domain Deposited 2016-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 351–398（48 aa） Fragment：Tetramerization domain of p73, UNP residues 351-398 Chain D 351–398（48 aa） Fragment：Tetramerization domain of p73, UNP residues 351-398	Mutation：E15K Mutation：E15K	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；310 K；Ionic strength (raw mmCIF value) 75；Pressure ambient NMR measurement conditions pH 6；310 K；Ionic strength (raw mmCIF value) 5；Pressure ambient NMR sample composition 0.5 mM [U-100% 13C; U-100% 15N] p63 tetramerization domain, 0.5 mM p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.5 mM p63 tetramerization domain, 0.5 mM [U-100% 13C; U-100% 15N] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.5 mM [U-100% 15N] p63 tetramerization domain, 0.5 mM [U-100% 13C] p63 tetramerization domain, 1 mM p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1 mM p63 tetramerization domain, 0.5 mM [U-100% 15N] p73 tetramerization domain, 0.5 mM [U-100% 13C] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.5 mM [U-100% 15N] p63 tetramerization domain, 0.5 mM p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 100% D2O \| 100% D2O NMR sample composition 0.5 mM p63 tetramerization domain, 0.5 mM [U-100% 15N] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 100% D2O \| 100% D2O NMR sample composition 0.5 mM [U-100% 15N] p63 tetramerization domain, 0.5 mM [U-100% 13C] p63 tetramerization domain, 0.5 mM [U-100% 15N] p73 tetramerization domain, 0.5 mM [U-100% 13C] p73 tetramerization domain, 25 mM HEPES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
2WQI Crystal structure of the human p73 tetramerization domain Deposited 2009-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain B 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain C 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain D 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 15 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M SODIUM CITRATE (PH 6.2), 40% PEG 600.	Resolution 1.70 Å R-free 0.254
2WQJ Crystal structure of a truncated variant of the human p73 tetramerization domain Deposited 2009-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain H 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain I 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain J 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain K 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain L 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 10 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M TRIS (PH 8.5), 0.9 M AMMONIUM PHOSPHATE.	Resolution 2.00 Å R-free 0.248
2WQJ Crystal structure of a truncated variant of the human p73 tetramerization domain Deposited 2009-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain B 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain C 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain D 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain E 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain F 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 10 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M TRIS (PH 8.5), 0.9 M AMMONIUM PHOSPHATE.	Resolution 2.00 Å R-free 0.248
2WQJ Crystal structure of a truncated variant of the human p73 tetramerization domain Deposited 2009-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain S 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain T 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain U 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain V 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain W 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain X 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 10 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M TRIS (PH 8.5), 0.9 M AMMONIUM PHOSPHATE.	Resolution 2.00 Å R-free 0.248
2WQJ Crystal structure of a truncated variant of the human p73 tetramerization domain Deposited 2009-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain M 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain N 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain O 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain P 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain Q 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain R 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 10 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M TRIS (PH 8.5), 0.9 M AMMONIUM PHOSPHATE.	Resolution 2.00 Å R-free 0.248
2WQJ Crystal structure of a truncated variant of the human p73 tetramerization domain Deposited 2009-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain 2 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain Y 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383 Chain Z 351–383（33 aa） Fragment：TRUNCATED TETRAMERIZATION DOMAIN, RESIDUES 351-383	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 10 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M TRIS (PH 8.5), 0.9 M AMMONIUM PHOSPHATE.	Resolution 2.00 Å R-free 0.248
2WTT Structure of the human p73 tetramerization domain (crystal form II) Deposited 2009-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain I 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain J 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain K 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain L 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 15 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M SODIUM CITRATE (PH 6.2), 40% PEG 600.	Resolution 2.30 Å R-free 0.287
2WTT Structure of the human p73 tetramerization domain (crystal form II) Deposited 2009-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain B 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain C 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain D 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 15 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M SODIUM CITRATE (PH 6.2), 40% PEG 600.	Resolution 2.30 Å R-free 0.287
2WTT Structure of the human p73 tetramerization domain (crystal form II) Deposited 2009-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain F 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain G 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain H 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 15 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M SODIUM CITRATE (PH 6.2), 40% PEG 600.	Resolution 2.30 Å R-free 0.287
2WTT Structure of the human p73 tetramerization domain (crystal form II) Deposited 2009-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain M 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain N 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain O 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399 Chain P 351–399（49 aa） Fragment：TETRAMERIZATION DOMAIN, RESIDUES 351-399	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；290 K；SITTING DROP VAPOR DIFFUSION AT 17 DEGREE C. PROTEIN SOLUTION: 15 MG/ML IN 20 MM TRIS (PH 8.5), 50 MM NACL. CRYSTALLIZATION BUFFER: 0.1 M SODIUM CITRATE (PH 6.2), 40% PEG 600.	Resolution 2.30 Å R-free 0.287
2XWC Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution Deposited 2010-11-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 112–311（200 aa） Fragment：DNA-BINDING DOMAIN, RESIDUES 112-311	Not recorded	ZN ZINC ION × 4 TAM TRIS(HYDROXYETHYL)AMINOMETHANE × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions 1.2M SODIUM POTASSIUM TARTRATE, 0.25% PEG MME 5000, 0.1M TRIS PH 9	Resolution 1.82 Å R-free 0.228
3VD0 structure of p73 DNA binding domain tetramer modulates p73 transactivation Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 115–312（198 aa） Fragment：unp residue 115-312 Chain B 115–312（198 aa） Fragment：unp residue 115-312 Chain C 115–312（198 aa） Fragment：unp residue 115-312 Chain D 115–312（198 aa） Fragment：unp residue 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；298 K；0.1M MES, 0.1M Na acetate, pH 6.1, temperature 298.0K	Resolution 2.95 Å R-free 0.254
3VD0 structure of p73 DNA binding domain tetramer modulates p73 transactivation Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain I 115–312（198 aa） Fragment：unp residue 115-312 Chain J 115–312（198 aa） Fragment：unp residue 115-312 Chain K 115–312（198 aa） Fragment：unp residue 115-312 Chain L 115–312（198 aa） Fragment：unp residue 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；298 K；0.1M MES, 0.1M Na acetate, pH 6.1, temperature 298.0K	Resolution 2.95 Å R-free 0.254
3VD1 structure of p73 DNA binding domain tetramer modulates p73 transactivation Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 115–312（198 aa） Fragment：unp residue 115-312 Chain B 115–312（198 aa） Fragment：unp residue 115-312 Chain C 115–312（198 aa） Fragment：unp residue 115-312 Chain D 115–312（198 aa） Fragment：unp residue 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；298 K；0.1M MES, 0.1M Na acetate, pH 6.1, temperature 298.0K	Resolution 2.95 Å R-free 0.285
3VD1 structure of p73 DNA binding domain tetramer modulates p73 transactivation Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain I 115–312（198 aa） Fragment：unp residue 115-312 Chain J 115–312（198 aa） Fragment：unp residue 115-312 Chain K 115–312（198 aa） Fragment：unp residue 115-312 Chain L 115–312（198 aa） Fragment：unp residue 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；298 K；0.1M MES, 0.1M Na acetate, pH 6.1, temperature 298.0K	Resolution 2.95 Å R-free 0.285
3VD2 structure of p73 DNA binding domain tetramer modulates p73 transactivation Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 115–312（198 aa） Fragment：unp residues 115-312 Chain B 115–312（198 aa） Fragment：unp residues 115-312 Chain C 115–312（198 aa） Fragment：unp residues 115-312 Chain D 115–312（198 aa） Fragment：unp residues 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1M Bis-tris, 0.1M Ammonium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K, pH 6.5	Resolution 4.00 Å R-free 0.284
3VD2 structure of p73 DNA binding domain tetramer modulates p73 transactivation Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain I 115–312（198 aa） Fragment：unp residues 115-312 Chain J 115–312（198 aa） Fragment：unp residues 115-312	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1M Bis-tris, 0.1M Ammonium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K, pH 6.5	Resolution 4.00 Å R-free 0.284
4A63 Crystal structure of the p73-ASPP2 complex at 2.6A resolution Deposited 2011-10-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 112–311（200 aa） Fragment：DNA-BINDING DOMAIN, RESIDUES 1-208	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 1.00M NA/KPO4, 0.1M ACETATE PH 4.5	Resolution 2.27 Å R-free 0.244
4A63 Crystal structure of the p73-ASPP2 complex at 2.6A resolution Deposited 2011-10-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 112–311（200 aa） Fragment：DNA-BINDING DOMAIN, RESIDUES 1-208	Not recorded	ZN ZINC ION × 1 ACT ACETATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions 1.00M NA/KPO4, 0.1M ACETATE PH 4.5	Resolution 2.27 Å R-free 0.244
4A63 Crystal structure of the p73-ASPP2 complex at 2.6A resolution Deposited 2011-10-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 112–311（200 aa） Fragment：DNA-BINDING DOMAIN, RESIDUES 1-208	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 1.00M NA/KPO4, 0.1M ACETATE PH 4.5	Resolution 2.27 Å R-free 0.244
4A63 Crystal structure of the p73-ASPP2 complex at 2.6A resolution Deposited 2011-10-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 112–311（200 aa） Fragment：DNA-BINDING DOMAIN, RESIDUES 1-208	Not recorded	ZN ZINC ION × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 1.00M NA/KPO4, 0.1M ACETATE PH 4.5	Resolution 2.27 Å R-free 0.244
4A63 Crystal structure of the p73-ASPP2 complex at 2.6A resolution Deposited 2011-10-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 112–311（200 aa） Fragment：DNA-BINDING DOMAIN, RESIDUES 1-208	Not recorded	ZN ZINC ION × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 1.00M NA/KPO4, 0.1M ACETATE PH 4.5	Resolution 2.27 Å R-free 0.244
4A63 Crystal structure of the p73-ASPP2 complex at 2.6A resolution Deposited 2011-10-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 112–311（200 aa） Fragment：DNA-BINDING DOMAIN, RESIDUES 1-208	Not recorded	ZN ZINC ION × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 1.00M NA/KPO4, 0.1M ACETATE PH 4.5	Resolution 2.27 Å R-free 0.244
4G82 Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element Deposited 2012-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 115–312（198 aa） Fragment：unp residues 115-312 Chain B 115–312（198 aa） Fragment：unp residues 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；298 K；0.1M TRIS, 20% PEG3350 , pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 3.10 Å R-free 0.268
4G83 Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element Deposited 2012-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 115–312（198 aa） Chain B 115–312（198 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M BTP, 20% PEG3350 , pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 4.00 Å R-free 0.307
4GUO structure of p73 DNA binding domain complex with 12 bp DNA Deposited 2012-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 115–312（198 aa） Fragment：unp residues 115-312 Chain B 115–312（198 aa） Fragment：unp residues 115-312 Chain C 115–312（198 aa） Fragment：unp residues 115-312 Chain D 115–312（198 aa） Fragment：unp residues 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；298 K；0.1M MES, 0.1M NA ACETATE, 15-17% PEG 20K, pH 6.0, VAPOR DIFFUSION, temperature 298K	Resolution 3.19 Å R-free 0.270
4GUO structure of p73 DNA binding domain complex with 12 bp DNA Deposited 2012-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain I 115–312（198 aa） Fragment：unp residues 115-312 Chain J 115–312（198 aa） Fragment：unp residues 115-312 Chain K 115–312（198 aa） Fragment：unp residues 115-312 Chain L 115–312（198 aa） Fragment：unp residues 115-312	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；298 K；0.1M MES, 0.1M NA ACETATE, 15-17% PEG 20K, pH 6.0, VAPOR DIFFUSION, temperature 298K	Resolution 3.19 Å R-free 0.270
4GUQ Structure of mutS139F p73 DNA binding domain complexed with 20BP DNA response element Deposited 2012-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 115–312（198 aa） Fragment：unp residues 115-312 Chain B 115–312（198 aa） Fragment：unp residues 115-312	Mutation：S139F Mutation：S139F	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；0.1 M Tris, 50-125 mM sodium acetate and 20-24% (w/v) PEG 3350, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.70 Å R-free 0.316
5HOB p73 homo-tetramerization domain mutant I Deposited 2016-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain B 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain C 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain D 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398	Mutation：E363K, K370E, E373R, R390E Mutation：E363K, K370E, E373R, R390E Mutation：E363K, K370E, E373R, R390E Mutation：E363K, K370E, E373R, R390E	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；15% w/v PEG Smear Medium, 0.1 M HEPES pH 7.5, 0.2 M magnesium chloride, 5 % 2-propanol, 10 % ethylene glycol	Resolution 1.22 Å R-free 0.214
5HOB p73 homo-tetramerization domain mutant I Deposited 2016-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain F 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain G 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398 Chain H 351–398（48 aa） Fragment：tetramerization domain, UNP residues 351-398	Mutation：E363K, K370E, E373R, R390E Mutation：E363K, K370E, E373R, R390E Mutation：E363K, K370E, E373R, R390E Mutation：E363K, K370E, E373R, R390E	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；15% w/v PEG Smear Medium, 0.1 M HEPES pH 7.5, 0.2 M magnesium chloride, 5 % 2-propanol, 10 % ethylene glycol	Resolution 1.22 Å R-free 0.214
5HOC p73 homo-tetramerization domain mutant II Deposited 2016-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 351–398（48 aa） Fragment：UNP residues 351-398 Chain B 351–398（48 aa） Fragment：UNP residues 351-398	Mutation：E363R, K370E, E373R, R390D Mutation：E363R, K370E, E373R, R390D	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；2 M Sodium chloride, 0.1 M sodium phosphate, 0.1 M potassium phosphate , 0.1 M HEPES pH 7.5	Resolution 1.36 Å R-free 0.247
5KBD Structural Studies of Transcription Factor p73 DNA Binding Domain Bound to PA26 20-mer Response Element Deposited 2016-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 115–312（198 aa） Fragment：UNP residues 115-312 Chain B 115–312（198 aa） Fragment：UNP residues 115-312	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M Tris pH 9.0, 50 mM Sodium Acetate, 16% (w/v) PEG 3350; 2:1 or 4:1 Protein:DNA ratio, 1:1 protein/DNA solution:well solution ratio	Resolution 2.80 Å R-free 0.308
6FGS Solution structure of p300Taz2-p73TA1 Deposited 2018-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 10–31（22 aa）	Not recorded	ZN ZINC ION × 3	SOLUTION NMR NMR measurement conditions pH 6.3；303 K；Ionic strength (raw mmCIF value) 50；Pressure AMBIENT NMR sample composition 700 uM [U-13C; U-15N] Fusion construct of p300 Taz2 and the transactivation domain 1 of p73, 25 mM MES, 50 mM NaCl, 0.5 mM TCEP, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6IJQ Solution structure of BCL-XL bound to P73-TAD peptide Deposited 2018-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 10–25（16 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 150；Pressure 1 NMR sample composition 1 mM [U-13C; U-15[U-13C; U-15N]N] Bcl-xL, 2 mM p73 peptide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.1 mM Bcl-XL, 1 mM p73 peptide, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
7EZJ Crystal structure of p73 DNA binding domain complex bound with 1 bp and 2 bp spacer DNA response elements. Deposited 2021-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 115–312（198 aa） Chain B 115–312（198 aa） Chain C 115–312（198 aa） Chain D 115–312（198 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293.15 K；100 mM MES, pH-6.0, 0.1 M Ammonium acetate, 12% w/v PEg20K	Resolution 2.90 Å R-free 0.306
7EZJ Crystal structure of p73 DNA binding domain complex bound with 1 bp and 2 bp spacer DNA response elements. Deposited 2021-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain I 115–312（198 aa） Chain J 115–312（198 aa） Chain K 115–312（198 aa） Chain L 115–312（198 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293.15 K；100 mM MES, pH-6.0, 0.1 M Ammonium acetate, 12% w/v PEg20K	Resolution 2.90 Å R-free 0.306
7EZJ Crystal structure of p73 DNA binding domain complex bound with 1 bp and 2 bp spacer DNA response elements. Deposited 2021-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain a 115–312（198 aa） Chain b 115–312（198 aa） Chain c 115–312（198 aa） Chain d 115–312（198 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293.15 K；100 mM MES, pH-6.0, 0.1 M Ammonium acetate, 12% w/v PEg20K	Resolution 2.90 Å R-free 0.306
7EZJ Crystal structure of p73 DNA binding domain complex bound with 1 bp and 2 bp spacer DNA response elements. Deposited 2021-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain i 115–312（198 aa） Chain j 115–312（198 aa） Chain k 115–312（198 aa） Chain l 115–312（198 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293.15 K；100 mM MES, pH-6.0, 0.1 M Ammonium acetate, 12% w/v PEg20K	Resolution 2.90 Å R-free 0.306
8P9D Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 A2 Deposited 2023-06-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 351–398（48 aa） Chain D 351–398（48 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293.15 K；20% PEG3350, 0.1M bis-tris propane pH 7.0, 0.2M salicylic, sodium salt	Resolution 2.70 Å R-free 0.252
8P9E Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 F11 Deposited 2023-06-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: trimeric	Chain B 351–398（48 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293.15 K；0.2M sodium chloride, 25% PEG3350, 0.1M bis-tris pH 6.5	Resolution 2.25 Å R-free 0.250
9GLQ Crystal structure of p73 tetramerisation domain in complex with darpins 1800 Deposited 2024-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 351–398（48 aa） Chain B 351–398（48 aa）	Not recorded	CO COBALT (II) ION × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；30% PEG2000MME, 0.15M potassium bromide	Resolution 2.10 Å R-free 0.248
9GNB Structure of p73 SAM domain in complex with DARPin B9 Deposited 2024-09-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 489–550（62 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；293 K；20% PEG6000, 0.1M bicine pH 9.0	Resolution 1.80 Å R-free 0.234

27 other PDB entries and 47 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	P73_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–50； UniProt 351–398

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8p9c
Deposition date deposition_date	2023-06-05
Structure title title	Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 F11
Keywords keywords	;p63, p73, tetramerization domain, darpin, heterotetramer, Structural Genomics, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN ;; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.12 Å
Radius of gyration Rg (electron density) rg_electron	20.14 Å
Forward intensity I(0) i0	15448100.00
Molecular weight molecular_weight	29346.0 kDa
Excluded volume excluded_volume	36717 Å³
Envelope volume envelope_volume	46141 Å³
Hydration-shell volume shell_volume	19401 Å³
Envelope diameter envelope_diameter	71.2 Å
Shell Rg shell_rg	26.45 Å
Envelope Rg envelope_rg	20.97 Å
Shape Rg shape_rg	20.13 Å
Total Rg total_rg	21.11 Å
Total atoms total_atoms	2063
Residues n_residues	259
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	71.3 Å
Rg (real space) rg_real	21.10 Å
Rg uncertainty (real space) rg_real_error	0.45 Å
I(0) (real space) i0_real	1.5450e+07
I(0) uncertainty (real space) i0_real_error	1.9650e+05
Rg (reciprocal space) rg_reciprocal	21.10 Å
I(0) (reciprocal space) i0_reciprocal	15450000.0000
Solution quality estimate total_estimate	0.7053
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	24.1 Å
Skewness Skewness skewness	0.316
Kurtosis Kurtosis kurtosis	-0.316
Angular range angular_range	— – 0.3750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	3195000.0000
Real-space data points n_real_points	69
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.840; Stabil: 1.000; Sysdev: 0.225; Positv: 1.000; Valcen: 0.978; Smooth: 0.994

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Tumor protein 63
Molecular weight formula_weight	7380.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2266

GSDDELLYLPVRGRETYEMLLEIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Tumor protein p73
Molecular weight formula_weight	6034.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GSDEDTYYLQVRGRKNFEILMKLKESLELMELVPQPLVDSYRQQQQLLQR

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Darpin 1810 F11
Molecular weight formula_weight	16873.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GSDLGKKLLEAAQTGQDDEVRILMANGADVNAMDMVGMTPLHLAAVNGHLEIVEVLLKTSADVNAQDYQGETPLHLAAIWGHLEIVEVLLKAGADVNANDLVGHTPLHLAAWSGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDIAEVLQKAA

来源 Source

来源生物 organism	Lama glama
通用名 common_name	Llama
NCBI Class编号 ncbi_taxonomy_id	9844
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	164

▶

8. Citations (1)

▶

Unit-cell length a length_a	84.024 Å
Unit-cell length b length_b	60.312 Å
Unit-cell length c length_c	53.576 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.26 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.760 Å
Low-resolution limit resolution_low	48.730 Å
R factor r_factor	0.1718
R_work r_work	0.1699
R_free r_free	0.2101

fit	/app/data/saxs_computation/p9/8p9c/8p9c.fit
pddf	/app/data/pr_computation/p9/8p9c/8p9c.pr.out
profile	/app/data/saxs_computation/p9/8p9c/8p9c.dat

Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 F11

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein 63

State in the Current Structure

Other States of the Same Protein in the Database

Tumor protein p73

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)