9bcx

Cryo-EM structure of the S. cerevisiae ORC-Cdc6-Mcm2-7-DNA complex with a fully closed Mcm2-Mcm5 DNA entry gate

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication licensing factor MCM2

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM2_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 2； PDBConstruct 1–868； UniProt 1–868

DNA replication licensing factor MCM3

Saccharomyces cerevisiae

UniProt A0A8H8ULI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8H8ULI2_YEASX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 3； PDBConstruct 1–971； UniProt 1–971

DNA replication licensing factor MCM5

Saccharomyces cerevisiae

UniProt A0A6A5PUY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PUY8_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 5； PDBConstruct 1–775； UniProt 1–775

DNA replication licensing factor MCM4

Saccharomyces cerevisiae

UniProt A0A8H4BU27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8H4BU27_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–933； UniProt 1–933

DNA replication licensing factor MCM6

Saccharomyces cerevisiae

UniProt P53091

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM6_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 6； PDBConstruct 1–1017； UniProt 1–1017

DNA replication licensing factor MCM7

Saccharomyces cerevisiae

UniProt P38132

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM7_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 7； PDBConstruct 1–845； UniProt 1–845

Origin recognition complex subunit 1

Saccharomyces cerevisiae

UniProt P54784

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B； PDBConstruct 1–914； UniProt 1–914

Origin recognition complex subunit 2

Saccharomyces cerevisiae

UniProt P32833

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC2_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain C； PDBConstruct 1–620； UniProt 1–620

Origin recognition complex subunit 3

Saccharomyces cerevisiae

UniProt P54790

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC3_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain D； PDBConstruct 1–616； UniProt 1–616

Origin recognition complex subunit 4

Saccharomyces cerevisiae

UniProt P54791

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC4_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain E； PDBConstruct 1–529； UniProt 1–529

Origin recognition complex subunit 5

Saccharomyces cerevisiae

UniProt P50874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC5_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain F； PDBConstruct 1–479； UniProt 1–479

Origin recognition complex subunit 6

Saccharomyces cerevisiae

UniProt P38826

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Cell division control protein 6 × 1 （P09119） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC6_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain G； PDBConstruct 1–435； UniProt 1–435

Cell division control protein 6

Saccharomyces cerevisiae

UniProt P09119

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） TAH11 isoform 1 × 1 （A0A8H4C095） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC6_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain I； PDBConstruct 1–513； UniProt 1–513

TAH11 isoform 1

Saccharomyces cerevisiae

UniProt A0A8H4C095

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 14 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （A0A8H8ULI2） DNA replication licensing factor MCM5 × 1 （A0A6A5PUY8） DNA replication licensing factor MCM4 × 1 （A0A8H4BU27） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） Cell division control protein 6 × 1 （P09119） DNA (39-MER) × 1 DNA (39-MER) × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8H4C095_YEASX
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 8； PDBConstruct 1–604； UniProt 1–604

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9bcx
Deposition date deposition_date	2024-04-10
Structure title title	Cryo-EM structure of the S. cerevisiae ORC-Cdc6-Mcm2-7-DNA complex with a fully closed Mcm2-Mcm5 DNA entry gate
Keywords keywords	DNA replication, Cryo-EM, OCCM-deltaC6, REPLICATION-DNA complex, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9bcx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9bcx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9bcx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.50 Å
Rg (electron density)	65.29 Å
Total Rg	65.33 Å
Atom count	57494
Residues	7165
Excluded volume	1023500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9bcx__assembly_1__model_1`	16-meric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	DNA replication licensing factor MCM2
Molecular weight formula_weight	98911.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2
Atom count atom_count	57494

MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPDIDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERDRLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREELTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSFAIYTLGH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	DNA replication licensing factor MCM3
Molecular weight formula_weight	107653.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQDDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSGSPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQLGLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTISTGRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNNLMVADDKVWRV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 3 Entity 3 polymer

Description description	DNA replication licensing factor MCM5
Molecular weight formula_weight	86505.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKRRLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 4 Entity 4 polymer

Description description	DNA replication licensing factor MCM4
Molecular weight formula_weight	105138.4 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEGNIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 5 Entity 5 polymer

Description description	DNA replication licensing factor MCM6
Molecular weight formula_weight	113110.2 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGPFVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLEDFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPFLQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGNGTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVDDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKKKTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRLAFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 6 Entity 6 polymer

Description description	DNA replication licensing factor MCM7
Molecular weight formula_weight	95049.9 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKGPKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRAIDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDALREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPYTGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYVVQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLSNCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDIDLQDA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	Origin recognition complex subunit 1
Molecular weight formula_weight	104546.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMESLEFYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKHYMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMKALNETLNSHVITFMTRLSFTAKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNKFVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILFKQTMKNDRICCVKLNISVEEAKRAMNEDETLRNL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 polymer

Description description	Origin recognition complex subunit 2
Molecular weight formula_weight	71342.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 9 Entity 9 polymer

Description description	Origin recognition complex subunit 3
Molecular weight formula_weight	72161.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWELYHQLHSHFHDQVDHIIDNIEADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKDESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHPTIKYEDINDEDGDFTEQNNDVSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNINTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVEFILSKMANNTNHNLQLLTKMLDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTFMFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVRENPINGHAKFVARFLEEELNITNFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIFPSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDFYIAFRETLPKEEILNFIRKDPSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQSTKSYDLVEKCVWRGI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 10 Entity 10 polymer

Description description	Origin recognition complex subunit 4
Molecular weight formula_weight	60772.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQLYGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQQSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEVFEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEHSRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISPWVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKSCSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIKAINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDNATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 11 Entity 11 polymer

Description description	Origin recognition complex subunit 5
Molecular weight formula_weight	55347.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAVWLEPVELVSWKPLLQAIARTVQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYESLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDSKINIKFIYTMLETSFLQRYSTHCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFIHLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLSENGQGESAITTNRDDLENSQTYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGRAAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKAESGSLSALREESLMKANIEVFQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 12 Entity 12 polymer

Description description	Origin recognition complex subunit 6
Molecular weight formula_weight	50369.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRSGRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 13 Entity 13 polymer

Description description	Cell division control protein 6
Molecular weight formula_weight	58112.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSAIPITPTKRIRRNLFDDAPATPPRPLKRKKLQFTDVTPESSPEKLQFGSQSIFLRTKALLQKSSELVNLNSSDGALPARTAEYEQVMNFLAKAISEHRSDSLYITGPPGTGKTAQLDMIIRQKFQSLPLSLSTPRSKDVLRHTNPNLQNLSWFELPDGRLESVAVTSINCISLGEPSSIFQKIFDSFQDLNGPTLQIKNMQHLQKFLEPYHKKTTFVVVLDEMDRLLHANTSETQSVRTILELFLLAKLPTVSFVLIGMANSLDMKDRFLSRLNLDRGLLPQTIVFQPYTAEQMYEIVIQKMSSLPTIIFQPMAIKFAAKKCAGNTGDLRKLFDVLRGSIEIYELEKRFLLSPTRGSLNSAQVPLTPTTSPVKKSYPEPQGKIGLNYIAKVFSKFVNNNSTRTRIAKLNIQQKLILCTIIQSLKLNSDATIDESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSIKKTKCKGKTKRFVDKIDVDLDMREFYDEMTKISILKPFLH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 14 Entity 14 polymer

Description description	TAH11 isoform 1
Molecular weight formula_weight	68486.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MSGTANSRRKEVLRVPVIDLNRVSDEEQLLPVVRAILLQHDTFLLKNYANKAVLDALLAGLTTKDLPDTSQGFDANFTGTLPLEDDVWLEQYIFDTDPQLRFDRKCRNESLCSIYSRLFKLGLFFAQLCVKSVVSSAELQDCISTSHYATKLTRYFNDNGSTHDGADAGATVLPTGDDFQYLFERDYVTFLPTGVLTIFPCAKAIRYKPSTMATTDNSWVSIDEPDCLLFHTGTLLARWSQGMHTTSPLQIDPRANIVSLTIWPPLTTPISSKGEGTIANHLLEQQIKAFPKVAQQYYPRELSILRLQDAMKFVKELFTVCETVLSLNALSRSTGVPPELHVLLPQISSMMKRKIVQDDILKLLTIWSDAYVVELNSRGELTMNLPKRDNLTTLTNKSRTLAFVERAESWYQQVIASKDEIMTDVPAFKINKRRSSSNSKTVLSSKVQTKSSNANALNNSRYLANSKENFMYKEKMPDSQANLMDRLRERERRSAALLSQRQKRYQQFLAMKMTQVFDILFSLTRGQPYTETYLSSLIVDSLQDSNNPIGTKEASEILAGLQGILPMDISVHQVDGGLKVYRWNSLDKNRFSKLLQIHKSKQQD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 15 Entity 15 polymer

Description description	DNA (39-MER)
Molecular weight formula_weight	11967.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	O

TATTTAAGTATTGTTTGTGCACTTGCCTGCAGGCCTTTT

Entity 16 Entity 16 polymer

Description description	DNA (39-MER)
Molecular weight formula_weight	12035.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	P

AAAAGGCCTGCAGGCAAGTGCACAAACAATACTTAAATA

Entity 17 Entity 17 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 18 Entity 18 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	53903

Cryo-EM structure of the S. cerevisiae ORC-Cdc6-Mcm2-7-DNA complex with a fully closed Mcm2-Mcm5 DNA entry gate

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication licensing factor MCM2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Origin recognition complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Origin recognition complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Origin recognition complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Origin recognition complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer