9w2y

Cryo-EM structure of complex III on the bovine heart submitochondrial particles, III-2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

Bos taurus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–446； UniProt 35–480 Author chain L； PDBConstruct 1–446； UniProt 35–480

Cytochrome b-c1 complex subunit 2, mitochondrial

Bos taurus

UniProt P23004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–425； UniProt 29–453 Author chain M； PDBConstruct 1–425； UniProt 29–453

Cytochrome b

Bos taurus

UniProt P00157

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–378； UniProt 2–379 Author chain N； PDBConstruct 1–378； UniProt 2–379

Cytochrome c1, heme protein, mitochondrial

Bos taurus

UniProt P00125

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 85–325 Author chain O； PDBConstruct 1–241； UniProt 85–325

Cytochrome b-c1 complex subunit Rieske, mitochondrial

Bos taurus

UniProt P13272

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_BOVIN
Isoform	—
PDB entities	5, 9
Chains and sequence ranges	Author chain E； PDBConstruct 1–196； UniProt 79–274 Author chain P； PDBConstruct 1–196； UniProt 79–274 Author chain I； PDBConstruct 1–57； UniProt 1–57 Author chain T； PDBConstruct 1–57； UniProt 1–57

Cytochrome b-c1 complex subunit 7

Bos taurus

UniProt P00129

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–105； UniProt 7–111 Author chain Q； PDBConstruct 1–105； UniProt 7–111

Cytochrome b-c1 complex subunit 8

Bos taurus

UniProt P13271

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–75； UniProt 2–76 Author chain R； PDBConstruct 1–75； UniProt 2–76

Cytochrome b-c1 complex subunit 6, mitochondrial

Bos taurus

UniProt P00126

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–67； UniProt 25–91 Author chain S； PDBConstruct 1–67； UniProt 25–91

Cytochrome b-c1 complex subunit 9

Bos taurus

UniProt P00130

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 10 × 2 （P07552） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–61； UniProt 2–62 Author chain U； PDBConstruct 1–61； UniProt 2–62

Cytochrome b-c1 complex subunit 10

Bos taurus

UniProt P07552

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P13272） Cytochrome b-c1 complex subunit 9 × 2 （P00130） PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–52； UniProt 2–53 Author chain V； PDBConstruct 1–52； UniProt 2–53

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9w2y
Deposition date deposition_date	2025-07-28
Structure title title	Cryo-EM structure of complex III on the bovine heart submitochondrial particles, III-2
Keywords keywords	respiratory chain complex, supercomplex, submitochondrial particles, MOTOR PROTEIN, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9w2y__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9w2y__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9w2y__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.77 Å
Rg (electron density)	55.89 Å
Total Rg	56.07 Å
Atom count	33266
Residues	4206
Excluded volume	593700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9w2y__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	49266.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	33266

TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	45151.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

AGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42489.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

TNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27323.3 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21640.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	12917.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

VSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	8856.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	7886.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	5824.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T

MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRG

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7080.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,U

VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 11 Entity 11 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	5979.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,V

LTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDSRLILDWVPYINGKFK

Source Source

Source organism organism	Bos taurus
Common name common_name	domestic cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Bos taurus

Entity 12 Entity 12 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 13 Entity 13 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Resolution resolution	2.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	135149

Cryo-EM structure of complex III on the bovine heart submitochondrial particles, III-2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer