7dgr

Activity optimized supercomplex state2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV2_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 9； PDBConstruct 1–217； UniProt 33–249

NADH-ubiquinone oxidoreductase chain 4

OrganismNot specified

UniProt P03910

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 4； PDBConstruct 1–459； UniProt 1–459

NADH-ubiquinone oxidoreductase chain 2

OrganismNot specified

UniProt P03892

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–347； UniProt 1–347

NADH-ubiquinone oxidoreductase chain 6

OrganismNot specified

UniProt P03924

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 7； PDBConstruct 1–175； UniProt 1–175

NADH-ubiquinone oxidoreductase chain 5

OrganismNot specified

UniProt P03920

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 6； PDBConstruct 1–606； UniProt 1–606

NADH-ubiquinone oxidoreductase chain 4L

OrganismNot specified

UniProt P03902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 5； PDBConstruct 1–98； UniProt 1–98

NADH-ubiquinone oxidoreductase chain 3

OrganismNot specified

UniProt P03898

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 3； PDBConstruct 1–115； UniProt 1–115

NADH-ubiquinone oxidoreductase chain 1

OrganismNot specified

UniProt P03887

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 1； PDBConstruct 1–318； UniProt 1–318

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

UniProt P25708

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV1_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 8； PDBConstruct 1–444； UniProt 21–464

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

OrganismNot specified

UniProt P15690

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS1_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A； PDBConstruct 1–704； UniProt 24–727

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

OrganismNot specified

UniProt P17694

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS2_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B； PDBConstruct 1–430； UniProt 34–463

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

OrganismNot specified

UniProt P23709

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS3_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain C； PDBConstruct 1–228； UniProt 39–266

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

OrganismNot specified

UniProt P42026

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS7_BOVIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain D； PDBConstruct 1–179； UniProt 38–216

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

OrganismNot specified

UniProt P42028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS8_BOVIN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain E； PDBConstruct 1–176； UniProt 37–212

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

OrganismNot specified

UniProt P25712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV3_BOVIN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain F； PDBConstruct 1–75； UniProt 35–109

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

OrganismNot specified

UniProt Q02375

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS4_BOVIN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain G； PDBConstruct 1–133； UniProt 43–175

NADH dehydrogenase [ubiquinone] iron-sulfur protein 5

OrganismNot specified

UniProt Q02379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS5_BOVIN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain H； PDBConstruct 1–105； UniProt 2–106

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

OrganismNot specified

UniProt P23934

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS6_BOVIN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain I； PDBConstruct 1–96； UniProt 29–124

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1

OrganismNot specified

UniProt Q02377

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA1_BOVIN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt Q02370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA2_BOVIN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain K； PDBConstruct 1–98； UniProt 2–99

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3

OrganismNot specified

UniProt Q02371

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA3_BOVIN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain L； PDBConstruct 1–83； UniProt 2–84

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

OrganismNot specified

UniProt P23935

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA5_BOVIN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain N； PDBConstruct 1–115； UniProt 2–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

OrganismNot specified

UniProt Q02366

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA6_BOVIN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain O； PDBConstruct 1–127； UniProt 2–128

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

OrganismNot specified

UniProt Q05752

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA7_BOVIN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain P； PDBConstruct 1–112； UniProt 2–113

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt P42029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA8_BOVIN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Q； PDBConstruct 1–171； UniProt 2–172

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

OrganismNot specified

UniProt P34943

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA9_BOVIN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain R； PDBConstruct 1–345； UniProt 36–380

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

OrganismNot specified

UniProt P34942

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAA_BOVIN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain S； PDBConstruct 1–320； UniProt 24–343

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

OrganismNot specified

UniProt Q8HXG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAB_BOVIN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain T； PDBConstruct 1–140； UniProt 2–141

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt O97725

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAC_BOVIN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain U； PDBConstruct 1–145； UniProt 1–145

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

OrganismNot specified

UniProt Q95KV7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAD_BOVIN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain V； PDBConstruct 1–143； UniProt 2–144

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt P52505

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_BOVIN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain M； PDBConstruct 1–88； UniProt 69–156 Author chain W； PDBConstruct 1–88； UniProt 69–156

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

OrganismNot specified

UniProt Q02378

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB1_BOVIN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain X； PDBConstruct 1–57； UniProt 1–57

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

OrganismNot specified

UniProt Q02374

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB2_BOVIN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Y； PDBConstruct 1–72； UniProt 37–108

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3

OrganismNot specified

UniProt Q02365

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB3_BOVIN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain Z； PDBConstruct 1–98； UniProt 1–98

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4

OrganismNot specified

UniProt P48305

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB4_BOVIN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain a； PDBConstruct 1–128； UniProt 2–129

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

OrganismNot specified

UniProt Q02380

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB5_BOVIN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain b； PDBConstruct 1–143； UniProt 47–189

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

OrganismNot specified

UniProt Q02367

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB6_BOVIN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain c； PDBConstruct 1–128； UniProt 1–128

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

OrganismNot specified

UniProt Q02368

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB7_BOVIN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain d； PDBConstruct 1–117； UniProt 2–118

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9

OrganismNot specified

UniProt Q02369

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB9_BOVIN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain f； PDBConstruct 1–178； UniProt 2–179

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

OrganismNot specified

UniProt Q8HXG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBB_BOVIN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain h； PDBConstruct 1–125； UniProt 30–154

NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

OrganismNot specified

UniProt Q02376

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC1_BOVIN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain i； PDBConstruct 1–49； UniProt 28–76

NADH dehydrogenase [ubiquinone] 1 subunit C2

OrganismNot specified

UniProt Q02827

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC2_BOVIN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain j； PDBConstruct 1–120； UniProt 1–120

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10

OrganismNot specified

UniProt Q02373

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBA_BOVIN
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain g； PDBConstruct 1–176； UniProt 1–176

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt Q02372

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB8_BOVIN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain e； PDBConstruct 1–158； UniProt 29–186

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

UniProt P31800

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_BOVIN
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain k； PDBConstruct 1–480； UniProt 1–480 Author chain w； PDBConstruct 1–480； UniProt 1–480

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt P23004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_BOVIN
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain l； PDBConstruct 1–453； UniProt 1–453 Author chain x； PDBConstruct 1–453； UniProt 1–453

Cytochrome b

OrganismNot specified

UniProt P00157

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_BOVIN
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain m； PDBConstruct 1–379； UniProt 1–379 Author chain y； PDBConstruct 1–379； UniProt 1–379

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P00125

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_BOVIN
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain o； PDBConstruct 1–241； UniProt 85–325 Author chain z； PDBConstruct 1–241； UniProt 85–325

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt P13272

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_BOVIN
Isoform	—
PDB entities	49, 55
Chains and sequence ranges	Author chain A0； PDBConstruct 1–196； UniProt 79–274 Author chain p； PDBConstruct 1–196； UniProt 79–274 Author chain B1； PDBConstruct 1–78； UniProt 1–78 Author chain v； PDBConstruct 1–78； UniProt 1–78

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt P00129

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR7_BOVIN
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain A1； PDBConstruct 1–111； UniProt 1–111 Author chain q； PDBConstruct 1–111； UniProt 1–111

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt P13271

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_BOVIN
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain A2； PDBConstruct 1–82； UniProt 1–82 Author chain r； PDBConstruct 1–82； UniProt 1–82

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P00126

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_BOVIN
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain B3； PDBConstruct 1–91； UniProt 1–91 Author chain s； PDBConstruct 1–91； UniProt 1–91

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt P07552

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_BOVIN
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain A3； PDBConstruct 1–56； UniProt 1–56 Author chain t； PDBConstruct 1–56； UniProt 1–56

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt P00130

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_BOVIN
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain B2； PDBConstruct 1–64； UniProt 1–64 Author chain u； PDBConstruct 1–64； UniProt 1–64

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt P00396

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_BOVIN
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain A9； PDBConstruct 1–514； UniProt 1–514

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P68530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_BOVIN
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain C4； PDBConstruct 1–227； UniProt 1–227

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00415

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_BOVIN
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain C2； PDBConstruct 1–261； UniProt 1–261

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

OrganismNot specified

UniProt P00423

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX41_BOVIN
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain A7； PDBConstruct 1–169； UniProt 1–169

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00426

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_BOVIN
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain C0； PDBConstruct 1–152； UniProt 1–152

Cytochrome c oxidase subunit 5B, mitochondrial

OrganismNot specified

UniProt P00428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5B_BOVIN
Isoform	—
PDB entities	61
Chains and sequence ranges	Author chain A6； PDBConstruct 1–129； UniProt 1–129

Cytochrome c oxidase subunit 6A2, mitochondrial

OrganismNot specified

UniProt P07471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6A2_BOVIN
Isoform	—
PDB entities	62
Chains and sequence ranges	Author chain A4； PDBConstruct 1–97； UniProt 1–97

Cytochrome c oxidase subunit 6B1

OrganismNot specified

UniProt P00429

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6B1_BOVIN
Isoform	—
PDB entities	63
Chains and sequence ranges	Author chain A5； PDBConstruct 1–86； UniProt 1–86

Cytochrome c oxidase subunit 6C

OrganismNot specified

UniProt P04038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6C_BOVIN
Isoform	—
PDB entities	64
Chains and sequence ranges	Author chain B4； PDBConstruct 1–74； UniProt 1–74

Cytochrome c oxidase subunit 7A1, mitochondrial

OrganismNot specified

UniProt P07470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX7A1_BOVIN
Isoform	—
PDB entities	65
Chains and sequence ranges	Author chain C3； PDBConstruct 1–80； UniProt 1–80

Cytochrome c oxidase subunit 7B, mitochondrial

OrganismNot specified

UniProt P13183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7B_BOVIN
Isoform	—
PDB entities	66
Chains and sequence ranges	Author chain B0； PDBConstruct 1–80； UniProt 1–80

Cytochrome c oxidase subunit 7C, mitochondrial

OrganismNot specified

UniProt P00430

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P10175） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7C_BOVIN
Isoform	—
PDB entities	67
Chains and sequence ranges	Author chain C1； PDBConstruct 1–63； UniProt 1–63

Cytochrome c oxidase subunit 8B, mitochondrial

OrganismNot specified

UniProt P10175

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 80	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P04394） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03910） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03892） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03924） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03902） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03898） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03887） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P25708） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P15690） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （P17694） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （P23709） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （P42026） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （P42028） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P25712） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q02375） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q02379） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P23934） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （Q02377） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q02370） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q02371） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （P23935） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q02366） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q05752） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P42029） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （P34943） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （P34942） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q8HXG6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （O97725） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q95KV7） Acyl carrier protein, mitochondrial × 2 （P52505） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （Q02378） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q02374） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q02365） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （P48305） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q02380） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q02367） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q02368） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q02369） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q8HXG5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q02376） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q02827） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q02373） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q02372） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （P31800） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome b-c1 complex subunit 7 × 2 （P00129） Cytochrome b-c1 complex subunit 8 × 2 （P13271） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P00126） Cytochrome b-c1 complex subunit 10 × 2 （P07552） Cytochrome b-c1 complex subunit 9 × 2 （P00130） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （P13272） Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） FE2/S2 (INORGANIC) CLUSTER × 3 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 6 ZINC ION × 2 NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 HEME-A × 2 COPPER (II) ION × 3 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8B_BOVIN
Isoform	—
PDB entities	68
Chains and sequence ranges	Author chain A8； PDBConstruct 1–70； UniProt 1–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7dgr
Deposition date deposition_date	2020-11-12
Structure title title	Activity optimized supercomplex state2
Keywords keywords	Complex I, respiratory, electron transport, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7dgr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7dgr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7dgr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	96.24 Å
Rg (electron density)	95.90 Å
Total Rg	95.99 Å
Atom count	107297
Residues	13811
Excluded volume	1921200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7dgr__assembly_1__model_1`	80-meric （80）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (81)

Entity 1 Entity 1 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Molecular weight formula_weight	23840.4 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9
Atom count atom_count	107305

GAGGALFVHRDTPENNPETPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEILQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Entity 2 Entity 2 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4
Molecular weight formula_weight	52130.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MLKYIIPTIMLMPLTWLSKNNMIWVNSTAHSLLISFTSLLLMNQFGDNSLNFSLLFFSDSLSTPLLILTMWLLPLMLMASQHHLSKENLTRKKLFITMLISLQLFLIMTFTAMELILFYILFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLAGSLPLLVALIYIQNTVGSLNFLMLQYWVQPVHNSWSNVFMWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMLRITLILNPMTDFMAYPFIMLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERIHSRTMILARGLQTLLPLMATWWLLASLTNLALPPTINLIGELFVVMSTFSWSNITIILMGVNMVITALYSLYMLIMTQRGKYTYHINNISPSFTRENALMSLHILPLLLLTLNPKIILGPLY

Entity 3 Entity 3 polymer

Description description	NADH-ubiquinone oxidoreductase chain 2
Molecular weight formula_weight	39274.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MNPIIFIIILLTIMLGTIIVMISSHWLLVWIGFEMNMLAIIPIMMKNHNPRATEASTKYFLTQSTASMLLMMAVIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQIFPSINLNLILTLSVLSILIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLPYNPTMTLLNLIIYIIMTSTMFTMFMANSTTTTLSLSHTWNKTPIMTVLILATLLSMGGLPPLSGFMPKWMIIQEMTKNNSIILPTFMAITALLNLYFYMRLTYSTTLTMFPSTNNMKMKWQFPLMKKMTFLPTMVVLSTMMLPLTPMLSVLE

Entity 4 Entity 4 polymer

Description description	NADH-ubiquinone oxidoreductase chain 6
Molecular weight formula_weight	19082.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MMLYIVFILSVIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEIWLSNKAVLGAFVTGLLMEFFMVYYVLKDKEVEVVFEFNGLGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

Entity 5 Entity 5 polymer

Description description	NADH-ubiquinone oxidoreductase chain 5
Molecular weight formula_weight	68327.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MNMFSSLSLVTLLLLTMPIMMMSFNTYKPSNYPLYVKTAISYAFITSMIPTMMFIHSGQELIISNWHWLTIQTLKLSLSFKMDYFSMMFIPVALFVTWSIMEFSMWYMYSDPNINKFFKYLLLFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAILYNRIGDIGFILAMAWFLTNLNTWDLQQIFMLNPSDSNMPLIGLALAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFYPLTENNKYIQSITLCLGAITTLFTAMCALTQNDIKKIIAFSTSSQLGLMMVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGGLFKAMPFTTTALIVGSLALTGMPFLTGFYSKDLIIEAANTSYTNAWALLMTLIATSFTAIYSTRIIFFALLGQPRFPTLVNINENNPLLINSIKRLLIGSLFAGYIISNNIPPTTIPQMTMPYYLKTTALIVTILGFILALEISNMTKNLKYHYPSNAFKFSTLLGYFPTIMHRLAPYMNLSMSQKSASSLLDLIWLEAILPKTISLAQMKASTLVTNQKGLIKLYFLSFLITILISMILFNFHE

Entity 6 Entity 6 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4L
Molecular weight formula_weight	10800.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSMVYMNIMMAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMAALTILNSHFTLASMMPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC

Entity 7 Entity 7 polymer

Description description	NADH-ubiquinone oxidoreductase chain 3
Molecular weight formula_weight	13058.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE

Entity 8 Entity 8 polymer

Description description	NADH-ubiquinone oxidoreductase chain 1
Molecular weight formula_weight	35688.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MFMINILMLIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSASMFILAPIMALGLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFTLSTLITTQEQMWLILPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTAILFLGTSHNPHMPELYTINFTIKSLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILTSGIPPQT

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	48562.1 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

SGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQQFAQQHQARQAAF

Entity 10 Entity 10 polymer

Description description	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Molecular weight formula_weight	77044.1 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

TATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKTKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTHTTWEDALSRVAGMLQSFQGNDVAAIAGGLVDAEALIALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGSHPFSQVLQEAKKPMVILGSSALQRNDGAAILAAVSNIAQKIRTSSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIQKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDVEGANYFQQASELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAHAVEEPSIC

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
Molecular weight formula_weight	49207.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ARQWQPDVEWAEQYGGAVMYPTKETAHWKPPPWNDVDPPKDTLVSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEFSKNFSLRIDELEEMLTNNRIWRNRTVDIGIVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSIRIISQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 12 Entity 12 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Molecular weight formula_weight	26464.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

ESSAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVPVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDTKPEAK

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Molecular weight formula_weight	20104.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

PSSTQPAVSQARAVVPKPAALPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR

Entity 14 Entity 14 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
Molecular weight formula_weight	20219.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

TYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 15 Entity 15 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
Molecular weight formula_weight	8451.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

SAESGKNEKGLPPNPKKQSPPKKPVSAAPTEPFDNTTYKNLQHHDYSTYTFLDLNLDLSKFRMPQPSSGRESPRH

Entity 16 Entity 16 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Molecular weight formula_weight	15361.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

AQDQTRDTQLITVDEKLDITTITGVPEEHIKTRKARIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNLVLTFSTKEDAVAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
Molecular weight formula_weight	12563.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

PFFDVQKRLGVDLDRWMTIQSAEQPHKIPSRCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLHAIRRQREKLIKEGKYTPPPHHSGQEEPRS

Entity 18 Entity 18 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
Molecular weight formula_weight	10551.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

GVRTSPTGEKVTHTGQVYDDGDYRKVRFVGRQKEVNENFAIDLIAEQPVSQVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQQHH

Entity 19 Entity 19 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Molecular weight formula_weight	8117.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MWFEVLPGIAVMGVCLFIPGMATARIHRFSNGGKEKRVAHYPYQWYLMERDRRVSGVNRSYVSKGLENID

Entity 20 Entity 20 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	10966.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

AAAAAIRGVRGKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSSKA

Entity 21 Entity 21 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
Molecular weight formula_weight	9226.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

AERVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRATPYNYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKRL

Entity 22 Entity 22 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Molecular weight formula_weight	13203.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

AGLLKKTTGLVGLAVCETPHERLKILYTKILDVLGHIPKNAAYRKYTEQITNEKLSMVKAEPDVKKLEERLQGGQIEEVILQAENELSLARKMIQWKPWEPLVEEPPASQWKWPI

Entity 23 Entity 23 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
Molecular weight formula_weight	14952.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

AASGLRQAAVAASTSVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHLFQLDISVKQGRDKVREMFKKNAHITDPRVVDLLVIKGKMELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Entity 24 Entity 24 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
Molecular weight formula_weight	12564.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

ASATRFIQWLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRREAMPPSIVMSSQKVLVAGKPAESSAVAASEKKAVSPAPPIKRWELSQDEPYL

Entity 25 Entity 25 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	19992.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

PGIVELPSLEDLKVQEVKVSSSVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNQCALEFFRQIKRHCAEPFTEYWTCIDYSGLQLFRRCRKQQAQFDECVLDKLGWVRPDLGDLSKVTKVKTDRPLPENPYHSRARPEPNPEVEGDLKPARHGSRLFFWTM

Entity 26 Entity 26 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
Molecular weight formula_weight	39174.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

LHHAVIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGDLGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKEAGVEKFIHISHLNADIKSSSKYLRSKAVGEKEVRETFPEATIIKPAEIFGREDRFLNYFANIRWFGGVPLISLGKKTVKQPVYIVDVTKGIINAIKDPDARGKTFAFVGPSRYLLFDLVQYVFAVAHRPFLPYPLPHFAYRWIGRLFEISPFEPWTTRDKVERIHTTDKILPHLPGLEDLGVEATPLELKAIEVLRRHRTYRWLSSEIEDVQPAKTIPTSGP

Entity 27 Entity 27 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Molecular weight formula_weight	36739.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

LQYGPLAYILGEKATKKMTEKSKLITVDGNICSGKSKLAKEIAEKLGLKHFPEAGIHYVDSTTGDGKPLPVQFSGNCSLEKFYDDPKSNDGNSYRLQAWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYRQGFIRKQCVDHYNQVKKVTICEYLPPHVVVYVDVPVPEVQSRIQKKGNPHEMKITSAYLQDIENAYKGTFLPEMSEKCEVLQYSAWEAQDAEKVVEDIEYLKYDKGPWLDQNDRNLHKLRMLVQDKLEVLNYTSIPVFLPEVTVGAHQSDQVFQEFTELPGRKYRAGYNEDVGDKWIWLK

Entity 28 Entity 28 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
Molecular weight formula_weight	14640.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

AKTVLRQYWDIPEGTECHRKTYATTSIGGAAGLVVSAYSVALKTPTSFLEGVARTGRYTFTAAAIGAIFGLTSCISAQVREKPDDPLNYLIGGCAGGLILGARTRSYGIGAAACAYMGLTAALVKMGQLEGWQVFAEPKV

Entity 29 Entity 29 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	17115.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MELLQVLKRGLQQVSGHGGLRGYLRVLFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTVKPPTARKFIWTNHKFNLSGTPQQYVPYSTTRKKIQEWVPPSTPYK

Entity 30 Entity 30 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Molecular weight formula_weight	16563.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

AASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMKWNRERRRLQIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATVMKDVPGWKVGESVFHTTRWVTPMMGELYGLRASEEVLSATYGFIWYT

Entity 31 Entity 31 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	10119.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,M

SDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 32 Entity 32 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Molecular weight formula_weight	6978.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MNLLQVVRDHWVHVLVPMGFVFGYYLDRKNDEKLTAFRNKSLLYKRELKPNEEVTWK

Entity 33 Entity 33 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
Molecular weight formula_weight	8500.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

AGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED

Entity 34 Entity 34 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
Molecular weight formula_weight	11160.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAHGHGHEHGPSKMELPDYKQWKIEGTPLETVQEKLAARGLRDPWGRNEAWRYMGGFANNVSFVGALLKGFKWGFAAFVVAIGAEYYLESQKKDKKHH

Entity 35 Entity 35 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
Molecular weight formula_weight	15075.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

SFPKYEASRLSSLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYYDPSRRGVIEDPALVRWTYARSANIYPNFRPNTKTSLLGALFGIGPLVFWYYVFKTDRDRKEKLIQEGKLDRTFNISY

Entity 36 Entity 36 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
Molecular weight formula_weight	16752.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

SGDHGKRLFIIKPSGFYDKRFLKLLRFYILLTGIPVAIGITLINVFIGEAELAEIPEGYVPEHWEYFKHPISRWIARTFFDGPEKNYERTMAILQIEAEKAELRLKELEVRRLMRARGDGPWFHYPTIDKELIDHSPKATPDN

Entity 37 Entity 37 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
Molecular weight formula_weight	15550.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSGYTPEEKLRLQQLRELRRRWLKDQELSPREPVLPPQRVSPVERFWNKFLQDGALWKNVIYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPMKEFPDQHH

Entity 38 Entity 38 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Molecular weight formula_weight	14460.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

GAHLARRYLGDASVEPDPLRMPTFPPDYGFPERKEREMVATQQEMNDAQLVLQQRDYCAHYLIRFLKCKRDSFPNFLACKHERHDWDYCEHLDYVKRMKEFERERRLLQRKKRREQR

Entity 39 Entity 39 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
Molecular weight formula_weight	21696.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

AFLSSGAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLLRARFDEHKNEKDMVKATQLLREAEEEFWHGQHPQPYIFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPVGGPRTEALPPARKQGDLPPLWWHIVTRPRERPM

Entity 40 Entity 40 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Molecular weight formula_weight	14469.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

ESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDIWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPIMESNCFDPSKIQLPEDED

Entity 41 Entity 41 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
Molecular weight formula_weight	5836.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

KFYIQEPPHGSPNWLKVGLTLGTSVFLWIYLIKQHNEDVLEYKRRNGLE

Entity 42 Entity 42 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C2
Molecular weight formula_weight	14117.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MMTGRQGRATFQFLPDEARSLPPPKLTDPRLAFVGFLGYCSGLIDNAIRRRPVLLAGLHRQLLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYGEVFEEFHPVR

Entity 43 Entity 43 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
Molecular weight formula_weight	21000.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MPDSWDKDVYPEPPRRTPAPSPQTSLPNPITYLTKAFDLLVDRPVTLVREFIERQHAKNKYYYYHREFRRVPDITECQEKDVLCMFEAEMQWRRDYKVDQEIVNIIQERLKACQQREGESHRQNCAKELEQFTQVVKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKAAKEAAAA

Entity 44 Entity 44 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	18758.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

ASHITKDMLPGPYPKTPEERAAAAKKYNMRVEDYEPYPDDGTGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVDTSPTPVNWNLMCKHLFGFVAFMLFMFWVGETYPAYQPVGPKQYPYNNLYLERGGDPNKEPEPVVHYEI

Entity 45 Entity 45 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	52796.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,w

MAASAVCRAAGAGTRVLLRTRRSPALLRSSDLRGTATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF

Entity 46 Entity 46 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	48203.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,x

MKLLTRAGSLSRFYSLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL

Entity 47 Entity 47 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42620.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,y

MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW

Entity 48 Entity 48 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27323.3 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,z

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK

Entity 49 Entity 49 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21640.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p,A0

SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG

Entity 50 Entity 50 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13501.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,A1

MAGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYNDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK

Entity 51 Entity 51 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9737.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r,A2

MGRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR

Entity 52 Entity 52 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	10638.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s,B3

MGLEDEQRMLTGSGDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK

Entity 53 Entity 53 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	6527.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t,A3

MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD

Entity 54 Entity 54 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7469.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u,B2

MVAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Entity 55 Entity 55 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	7964.3 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v,B1

MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY

Entity 56 Entity 56 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	57065.8 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A9

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK

Entity 57 Entity 57 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26040.4 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C4

MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML

Entity 58 Entity 58 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	29957.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C2

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS

Entity 59 Entity 59 polymer

Description description	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Molecular weight formula_weight	19602.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A7

MLATRVFSLIGRRAISTSVCVRAHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK

Entity 60 Entity 60 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	16758.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C0

MLGAAVRRCSVAAAAVARASPRGLLHPTPAPGQAAAVQSLRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Entity 61 Entity 61 polymer

Description description	Cytochrome c oxidase subunit 5B, mitochondrial
Molecular weight formula_weight	13852.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A6

MASRLLRGVGALASQALRARGPNGVSVVRSMASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH

Entity 62 Entity 62 polymer

Description description	Cytochrome c oxidase subunit 6A2, mitochondrial
Molecular weight formula_weight	10819.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A4

MALPLKSLSRGLASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEKP

Entity 63 Entity 63 polymer

Description description	Cytochrome c oxidase subunit 6B1
Molecular weight formula_weight	10170.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A5

MAEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI

Entity 64 Entity 64 polymer

Description description	Cytochrome c oxidase subunit 6C
Molecular weight formula_weight	8626.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B4

MSTALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK

Entity 65 Entity 65 polymer

Description description	Cytochrome c oxidase subunit 7A1, mitochondrial
Molecular weight formula_weight	9076.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C3

MRALRVSQALVRSFSSTARNRFENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK

Entity 66 Entity 66 polymer

Description description	Cytochrome c oxidase subunit 7B, mitochondrial
Molecular weight formula_weight	9077.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B0

MFPLAKNALSRLRVQSIQQAVARQIHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ

Entity 67 Entity 67 polymer

Description description	Cytochrome c oxidase subunit 7C, mitochondrial
Molecular weight formula_weight	7342.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1

MLGQSIRRFTTSVVRRSHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK

Entity 68 Entity 68 polymer

Description description	Cytochrome c oxidase subunit 8B, mitochondrial
Molecular weight formula_weight	7650.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A8

MLRLAPTVRLLQAPLRGWAVPKAHITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA

Entity 69 Entity 69 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 70 Entity 70 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 71 Entity 71 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 72 Entity 72 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 73 Entity 73 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 74 Entity 74 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 75 Entity 75 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 76 Entity 76 non-polymer

Description description	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	743.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 77 Entity 77 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 78 Entity 78 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 79 Entity 79 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 80 Entity 80 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 81 Entity 81 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	57806

Activity optimized supercomplex state2

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer