6chb

Crystal structure of a natively-glycosylated BG505 SOSIP.664 HIV-1 Envelope Trimer in complex with the broadly-neutralizing antibodies BG18 and IOMA

Method: X-RAY DIFFRACTION D_max: 208.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope glycoprotein gp41

Human immunodeficiency virus 1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain A； UniProt 509–661 Chain B； UniProt 509–661 Chain C； UniProt 509–661	Not recorded	Envelope glycoprotein gp120 × 3 （Q2N0S6） BG18 Heavy Chain × 3 BG18 Light Chain × 3 IOMA Heavy Chain × 3 IOMA Light Chain × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；5% Tacismate pH 8.0, 15% PEG 3350	Resolution 6.80 Å R-free 0.417

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6CHB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6CDE Cryo-EM structure at 3.8 A resolution of vaccine-elicited antibody vFP20.01 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-02-08	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 1 509–661（153 aa） Chain D 509–661（153 aa） Chain d 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9 MAN alpha-D-mannopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6CDI Cryo-EM structure at 3.6 A resolution of vaccine-elicited antibody vFP16.02 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-02-08	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 509–661（153 aa） Chain D 509–661（153 aa） Chain c 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6CH7 XFEL crystal structure of a natively-glycosylated BG505 SOSIP.664 HIV-1 Envelope Trimer in complex with the broadly-neutralizing antibodies BG18 and 35O22 Deposited 2018-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；5% Tacismate pH 8.0, 14% PEG 3350, 0.1M Tris pH 8.0	Resolution 3.80 Å R-free 0.262
6CH8 Crystal structure of a natively-glycosylated BG505 SOSIP.664 HIV-1 Envelope Trimer in complex with the broadly-neutralizing antibodies BG18 and 35O22 Deposited 2018-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；5% Tacismate pH 8.0, 15% PEG 3350	Resolution 4.10 Å R-free 0.274
6CM3 BG505 SOSIP in complex with sCD4, 17b, 8ANC195 Deposited 2018-03-02	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.54 Å
6CRQ Glutaraldehyde-treated BG505 SOSIP.664 Env in complex with PGV04 Fab Deposited 2018-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 509–661（153 aa） Chain G 509–661（153 aa） Chain H 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；50 mM Tris, 150 mM NaCl, 0.3 mM DDM. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6CUE Cryo-EM structure at 4.0 A resolution of vaccine-elicited antibody vFP7.04 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-03-26	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 1 509–661（153 aa） Chain D 509–661（153 aa） Chain d 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6CUF Cryo-EM structure at 4.2 A resolution of vaccine-elicited antibody vFP1.01 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-03-26	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 509–661（153 aa） Chain D 509–661（153 aa） Chain c 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6DE7 Crystal Structure at 4.3 A Resolution of Glycosylated HIV-1 Clade A BG505 SOSIP.664 Prefusion Env Trimer with Interdomain Stabilization 113C-429GCG in Complex with Broadly Neutralizing Antibodies PGT122 and 35O22 Deposited 2018-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa）	Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；293 K；24%PEG400, 3% PEG3350, 0.1M sodium acetate 5.5, 0.2M LiSO4	Resolution 4.12 Å R-free 0.258
6DID HIV Env BG505 SOSIP with polyclonal Fabs from immunized rabbit #3417 post-boost#1 Deposited 2018-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Fragment：GP41 domain residues 509-661 Chain I 509–661（153 aa） Fragment：GP41 domain residues 509-661 Chain J 509–661（153 aa） Fragment：GP41 domain residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.71 Å
6MAR HIV-1 Envelope Glycoprotein Clone BG505 delCT N332T in complex with broadly neutralizing antibody Fab PGT151 Deposited 2018-08-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain B 503–708（206 aa） Chain D 503–708（206 aa） Chain F 503–708（206 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6MN7 Cryo-EM structure of BG505.SOSIP.664 in complex with BF520.1 antigen binding fragment Deposited 2018-10-01	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 509–661（153 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
6MPG Cryo-EM structure at 3.2 A resolution of HIV-1 fusion peptide-directed antibody, A12V163-b.01, elicited by vaccination of Rhesus macaques, in complex with stabilized HIV-1 Env BG505 DS-SOSIP, which was also bound to antibodies VRC03 and PGT122 Deposited 2018-10-06	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 509–661（153 aa） Chain D 509–661（153 aa） Chain U 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6MPH Cryo-EM structure at 3.8 A resolution of HIV-1 fusion peptide-directed antibody, DF1W-a.01, elicited by vaccination of Rhesus macaques, in complex with stabilized HIV-1 Env BG505 DS-SOSIP, which was also bound to antibodies VRC03 and PGT122 Deposited 2018-10-06	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 6 509–661（153 aa） Chain D 509–661（153 aa） Chain E 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6N1W Cryo-EM structure at 4.2 A resolution of vaccine-elicited antibody DFPH-a.15 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-11-12	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 509–661（153 aa） Chain D 509–661（153 aa） Chain d 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6UM5 Cryo-EM structure of HIV-1 neutralizing antibody DH270 UCA3 in complex with CH848 10.17DT Env Deposited 2019-10-09	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Chain F 509–661（153 aa） Chain J 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6UM6 Cryo-EM structure of HIV-1 neutralizing antibody DH270.6 in complex with CH848 10.17DT Env Deposited 2019-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 508–661（154 aa） Chain F 508–661（154 aa） Chain J 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
6UM7 Cryo-EM structure of vaccine-elicited HIV-1 neutralizing antibody DH270.mu1 in complex with CH848 10.17DT Env Deposited 2019-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 1 508–661（154 aa） Chain D 508–661（154 aa） Chain H 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6V8Z VRC03 and 10-1074 Bound BG505 F14 HIV-1 SOSIP Envelope Trimer Structure Deposited 2019-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 515–661（147 aa） Fragment：UNP residues 515-661 Chain H 515–661（147 aa） Fragment：UNP residues 515-661 Chain N 515–661（147 aa） Fragment：UNP residues 515-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7LL1 Cryo-EM structure of BG505 DS-SOSIP in complex with glycan276-dependent broadly neutralizing antibody VRC40.01 Fab Deposited 2021-02-03	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Chain D 509–661（153 aa） Chain I 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 2.5 S before plunging	Resolution 3.73 Å
7LL2 Cryo-EM structure of BG505 DS-SOSIP in complex with Glycan276-Dependent Broadly Neutralizing Antibody VRC33.01 Fab Deposited 2021-02-03	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Chain D 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 2.5 S before plunging	Resolution 3.73 Å
7N65 Complex structure of HIV superinfection Fab QA013.2 and BG505.SOSIP.664 Deposited 2021-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 508–661（154 aa） Chain F 508–661（154 aa） Chain J 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9 MAN alpha-D-mannopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；1X PBS at pH 7.4, made fresh. cryo-EM vitrification conditions Cryogen ETHANE；3ul sample volume, blotted for 3-4 seconds	Resolution 4.15 Å
8DOW Cryo-EM structure of HIV-1 Env(CH848 10.17 DS.SOSIP_DT) in complex with DH1030.1 Fab Deposited 2022-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 508–661（154 aa） Chain F 508–661（154 aa） Chain J 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.69 Å
8FR6 Antibody vFP53.02 in complex with HIV-1 envelope trimer BG505 DS-SOSIP Deposited 2023-01-06	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain F 509–661（153 aa）	Mutation：BG505 DS-SOSIP construct Mutation：BG505 DS-SOSIP construct Mutation：BG505 DS-SOSIP construct	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8G4M Vaccine-elicited human antibody 2C06 in complex with HIV-1 envelope trimer BG505 DS-SOSIP Deposited 2023-02-10	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS + 0.005%(w/v) DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
8G4T Vaccine-elicited human antibody 2C09 in complex with HIV-1 envelope trimer BG505 DS-SOSIP Deposited 2023-02-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain F 509–661（153 aa）	Mutation：BG505 DS-SOSIP mutations Mutation：BG505 DS-SOSIP mutations Mutation：BG505 DS-SOSIP mutations	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS + 0.1mM DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
9PNI Cryo-EM structure of J601-1B2 Fab in complex with HIV-1 BG505 DS-SOSIP Env trimer Deposited 2025-07-21	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 19 MAN alpha-D-mannopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS buffer supplemented with 0.1 mM DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.83 Å
9PNN Cryo-EM structure of J601-A6 Fab in complex with HIV-1 BG505 DS-SOSIP Env trimer Deposited 2025-07-21	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS + 0.005% (w/v) DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å

28 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q2N0S7_9HIV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–153； UniProt 509–661 Author chain B； PDBConstruct 1–153； UniProt 509–661 Author chain C； PDBConstruct 1–153； UniProt 509–661

Envelope glycoprotein gp120

Human immunodeficiency virus 1

UniProt Q2N0S6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain F； UniProt 30–508 Chain G； UniProt 30–508 Chain H； UniProt 30–508	Not recorded	Envelope glycoprotein gp41 × 3 （Q2N0S7） BG18 Heavy Chain × 3 BG18 Light Chain × 3 IOMA Heavy Chain × 3 IOMA Light Chain × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；5% Tacismate pH 8.0, 15% PEG 3350	Resolution 6.80 Å R-free 0.417

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6CHB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3J5M Cryo-EM structure of the BG505 SOSIP.664 HIV-1 Env trimer with 3 PGV04 Fabs Deposited 2013-10-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–504（475 aa） Fragment：UNP residues 30-504 Chain E 30–504（475 aa） Fragment：UNP residues 30-504 Chain I 30–504（475 aa） Fragment：UNP residues 30-504	Mutation：T332N,A501C Mutation：T332N,A501C Mutation：T332N,A501C	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer TBS；pH 7.5；TBS cryo-EM vitrification conditions Specimen was prepared for cryo-EM by applying 3 microliters of sample to a freshly plasma cleaned holey carbon C-flat grid (Protochips, Inc.), allowing the sample to adsorb to the grid for 30 seconds, followed by blotting with a small piece of filter paper and plunge-freezing into liquid ethane using a manual cryo-plunger in an ambient environment (4 C).；Cryogen ETHANE；3 uL sample applied to grid, adsorbed for 30 seconds, blotted, and plunge-frozen in liquid ethane	Resolution 5.80 Å
4NCO Crystal Structure of the BG505 SOSIP gp140 HIV-1 Env trimer in Complex with the Broadly Neutralizing Fab PGT122 Deposited 2013-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–504（475 aa） Fragment：UNP residues 30-504 Chain E 30–504（475 aa） Fragment：UNP residues 30-504 Chain I 30–504（475 aa） Fragment：UNP residues 30-504	Mutation：T332N,A501C Mutation：T332N,A501C Mutation：T332N,A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.5；293 K；0.1 M CAPS, 2 M ammonium sulfate, 0.2 M lithium sulfate, pH 10.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 4.70 Å R-free 0.389
4ZMJ Crystal Structure of Ligand-Free BG505 SOSIP.664 HIV-1 Env Trimer Deposited 2015-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 509–661（153 aa） Chain G 30–504（475 aa）	Mutation：I559P, T605C Mutation：T332N, A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 45	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；26% PEG 400, 3.2% PEG 3350, and 0.1M sodium acetate pH 5.5	Resolution 3.31 Å R-free 0.285
5ACO Cryo-EM structure of PGT128 Fab in complex with BG505 SOSIP.664 Env trimer Deposited 2015-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：GP120, RESIDUES 30-505 Chain B 509–661（153 aa） Fragment：GP41, RESIDUES 509-661 Chain C 30–505（476 aa） Fragment：GP120, RESIDUES 30-505 Chain D 30–505（476 aa） Fragment：GP120, RESIDUES 30-505 Chain E 509–661（153 aa） Fragment：GP41, RESIDUES 509-661 Chain F 509–661（153 aa） Fragment：GP41, RESIDUES 509-661	Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer 50 MM TRIS, 150 MM NACL, 0.675 MM DDM；pH 7.4；50 MM TRIS, 150 MM NACL, 0.675 MM DDM cryo-EM vitrification conditions Cryogen ETHANE；FROZEN IN LIQUID ETHANE AT 4 DEGREES C.	Resolution 4.36 Å
5C7K Crystal structure BG505 SOSIP gp140 HIV-1 Env trimer bound to broadly neutralizing antibodies PGT128 and 8ANC195 Deposited 2015-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 30–507（478 aa） Fragment：UNP Residues 30-507 Chain D 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；280 K；0.05 M lithium sulfate, 0.05 M sodium sulfate, 26% (w/v) PEG 400 and 0.1 M Tris-HCl pH 8.3	Resolution 4.60 Å R-free 0.295
5CEZ Crystal Structure of the BG505 SOSIP gp140 HIV-1 Env trimer in Complex with an early putative precursor of the PGT121 family at 3.0 Angstrom Deposited 2015-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 31–508（478 aa） Fragment：UNP residues 31-505	Mutation：N137A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2 M CaCl2, 28% (v/v) PEG 400 and 0.1 M Hepes pH 7.5	Resolution 3.03 Å R-free 0.266
5CEZ Crystal Structure of the BG505 SOSIP gp140 HIV-1 Env trimer in Complex with an early putative precursor of the PGT121 family at 3.0 Angstrom Deposited 2015-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2 M CaCl2, 28% (v/v) PEG 400 and 0.1 M Hepes pH 7.5	Resolution 3.03 Å R-free 0.266
5CJX Crystal structure of 8ANC195 Fab in complex with BG505 SOSIP.664 HIV-1 Env trimer Deposited 2015-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 32–505（474 aa） Fragment：UNP residues 32-505 Chain J 509–661（153 aa） Fragment：UNP residues 509-661 Chain K 32–505（474 aa） Fragment：UNP residues 32-505 Chain X 509–661（153 aa） Fragment：UNP residues 509-661 Chain Y 32–505（474 aa） Fragment：UNP residues 32-505	Mutation：I559P, T605C Mutation：T332N, A501C Mutation：I559P, T605C Mutation：T332N, A501C Mutation：I559P, T605C Mutation：T332N, A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；298 K；0.1 M Tris, pH 8.0, 15% PEG3350, 2% v/v 1,4-dioxane	Resolution 3.58 Å R-free 0.286
5D9Q Crystal Structure of the BG505 SOSIP gp140 HIV-1 Env trimer in Complex with the Broadly Neutralizing Fab PGT122 and scFv NIH45-46 Deposited 2015-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 30–501（472 aa） Chain G 30–501（472 aa） Chain J 30–501（472 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；2.4 M ammonium sulfate, 0.1 M Tris, pH 8.0	Resolution 4.40 Å R-free 0.320
5FYL Crystal Structure at 3.7 A Resolution of Fully Glycosylated HIV-1 Clade A BG505 SOSIP.664 Prefusion Env Trimer in Complex with Broadly Neutralizing Antibodies PGT122 and 35O22 Deposited 2016-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：GP120 ENV ECTODOMAIN Chain G 30–505（476 aa） Fragment：GP120 ENV ECTODOMAIN	Mutation：YES Mutation：YES	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；0.18 M LI2SO4, 4.79% PEG 1500, 14.4% ISOPROPANOL, 10 MM YTTRIUM CHLORIDE, 0.09 M SODIUM ACETATE PH 5.5	Resolution 3.10 Å R-free 0.307
5I8H Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer in Complex with V3 Loop-targeting Antibody PGT122 Fab and Fusion Peptide-targeting Antibody VRC34.01 Fab Deposited 2016-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 30–508（479 aa） Chain B 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.5M Sodium Chloride, 0.1M Tris-HCl pH8.5, 5% PEG 8000 and 20% 2-methyl-2, 4- pentanediol	Resolution 4.30 Å R-free 0.309
5I8H Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer in Complex with V3 Loop-targeting Antibody PGT122 Fab and Fusion Peptide-targeting Antibody VRC34.01 Fab Deposited 2016-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 30–508（479 aa） Chain D 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.5M Sodium Chloride, 0.1M Tris-HCl pH8.5, 5% PEG 8000 and 20% 2-methyl-2, 4- pentanediol	Resolution 4.30 Å R-free 0.309
5T3S HIV gp140 trimer MD39-10MUTA in complex with Fabs PGT124 and 35022 Deposited 2016-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Chain G 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.1；277 K；5% Peg6000 0.1M citric acid	Resolution 4.50 Å R-free 0.309
5T3X 3.9 Angstrom Crystal Structure of a Fully and Natively Glycosylated BG505 SOSIP.664 HIV-1 Env Trimer in Complex with the Broadly Neutralizing Antibodies IOMA and 10-1074. Deposited 2016-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-611 Chain G 30–508（479 aa） Fragment：UNP residues 30-508	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；200 mM ammonium citrate tribasic pH 7.0 100 mM imidazole pH 7.0 20% PEG MME 2,000	Resolution 3.90 Å R-free 0.331
5T3Z 3.5 Angstrom Crystal Structure of a Fully and Natively Glycosylated BG505 SOSIP.664 HIV-1 Env Trimer in Complex with the Broadly Neutralizing Antibodies IOMA and 10-1074 Deposited 2016-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-611 Chain G 30–508（479 aa） Fragment：UNP residues 30-508	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；200 mM ammonium citrate tribasic pH 7.0 100 mM imidazole pH 7.0 20% PEG MME 2,000	Resolution 3.50 Å R-free 0.306
5THR Cryo-EM structure of a BG505 Env-sCD4-17b-8ANC195 complex Deposited 2016-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 509–661（153 aa） Fragment：UNP residues 509-661 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 30–505（476 aa） Fragment：UNP residue 30-505 Chain E 30–505（476 aa） Fragment：UNP residue 30-505 Chain F 30–505（476 aa） Fragment：UNP residue 30-505	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 8.90 Å
5U1F Initial contact of HIV-1 Env with CD4: Cryo-EM structure of BG505 DS-SOSIP trimer in complex with CD4 and antibody PGT145 Deposited 2016-11-28	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 29–502（474 aa） Fragment：UNP residues 29-502 Chain B 508–661（154 aa） Chain C 29–502（474 aa） Fragment：UNP residues 29-502 Chain D 29–502（474 aa） Fragment：UNP residues 29-502 Chain E 508–661（154 aa） Chain F 508–661（154 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
5UTF Crystal Structure of a Stabilized DS-SOSIP.6mut BG505 gp140 HIV-1 Env Trimer, Containing Mutations I201C-P433C (DS), L154M, Y177W, N300M, N302M, T320L, I420M in Complex with Human Antibodies PGT122 and 35O22 at 4.3 A Deposited 2017-02-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Chain G 30–510（481 aa）	Mutation：I201C-P433C (DS) Mutation：L154M, Y177W, N300M, N302M, T320L, I420M	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；293 K；13.2% PEG 400, 6.6% PEG 8000, 0.1M. Sodium acetate/Acetic acid pH 4.5	Resolution 3.50 Å R-free 0.299
5UTY Crystal Structure of a Stabilized DS-SOSIP.mut4 BG505 gp140 HIV-1 Env Trimer, Containing Mutations I201C-P433C (DS), L154M, N300M, N302M, T320L in Complex with Human Antibodies PGT122 and 35O22 at 4.1 Angstrom Deposited 2017-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 29–505（477 aa） Fragment：UNP residues 29-505	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；10.5% PEG 4000, 0.2M AmSO4, 0.1M NaoAc pH 4.6	Resolution 3.41 Å R-free 0.288
5V7J Crystal Structure at 3.7 A Resolution of Glycosylated HIV-1 Clade A BG505 SOSIP.664 Prefusion Env Trimer with Four Glycans (N197, N276, N362, and N462) removed in Complex with Neutralizing Antibodies 3H+109L and 35O22. Deposited 2017-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 31–505（475 aa） Fragment：UNP residues 31-505	Mutation：S198A, T278A, S365A, T464A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；4.95% isopropanol, 8.25% PEG 3350, 0.2M ammonium citrate, pH 4.5	Resolution 2.91 Å R-free 0.339
5V8L BG505 SOSIP.664 trimer in complex with broadly neutralizing HIV antibodies 3BNC117 and PGT145 Deposited 2017-03-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain D 30–505（476 aa） Fragment：UNP residues 30-505 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
5V8M BG505 SOSIP.664 trimer in complex with broadly neutralizing HIV antibody 3BNC117 Deposited 2017-03-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 30–505（476 aa） Fragment：UNP residues 30-505 Chain G 30–505（476 aa） Fragment：UNP residues 30-505 Chain I 509–661（153 aa） Fragment：UNP residues 509-661 Chain J 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5VIY BG505 SOSIP.664 in complex with broadly neutralizing antibodies BG1 and 8ANC195 Deposited 2017-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 509–661（153 aa） Fragment：UNP residues 509-661 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 30–508（479 aa） Fragment：UNP residues 30-505 Chain E 30–508（479 aa） Fragment：UNP residues 30-505 Chain F 30–508（479 aa） Fragment：UNP residues 30-505	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 13	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.20 Å
5VJ6 BG505 SOSIP.664 in complex with broadly neutralizing antibodies PG9 and 8ANC195 Deposited 2017-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 509–661（153 aa） Fragment：UNP residues 509-661 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 30–505（476 aa） Fragment：UNP residues 30-505 Chain E 30–505（476 aa） Fragment：UNP residues 30-505 Chain F 30–505（476 aa） Fragment：UNP residues 30-505	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 11.50 Å
5W6D Crystal structure of BG505-SOSIP.v4.1-GT1-N137A in complex with Fabs 35022 and 9H/109L Deposited 2017-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；277 K；0.2M NaCl, 34% PEG 300, 0.1M NaOAc	Resolution 3.20 Å R-free 0.267
5WDU HIV-1 Env BG505 SOSIP.664 H72C-H564C trimer in complex with bNAbs PGT122 Fab, 35O22 Fab and NIH45-46 scFv Deposited 2017-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 21 PDB declaration: 21-meric	Chain F 31–501（471 aa） Chain G 31–501（471 aa） Chain Q 31–501（471 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；8% (w/v) polyethylene glycol 8000, 0.1 M Tris, pH 8.5	Resolution 7.00 Å R-free 0.363
6B0N Crystal structure of the cleavage-independent prefusion HIV Env glycoprotein trimer of the clade A BG505 isolate (NFL construct) in complex with Fabs PGT122 and PGV19 at 3.39 A Deposited 2017-09-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain G 30–503（474 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36 MAN alpha-D-mannopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1M HEPES (pH 7.0), 15% (w/v) PEG4000, and cryo-protected with 25% glycerol	Resolution 3.40 Å R-free 0.346
6CH7 XFEL crystal structure of a natively-glycosylated BG505 SOSIP.664 HIV-1 Envelope Trimer in complex with the broadly-neutralizing antibodies BG18 and 35O22 Deposited 2018-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 30–508（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；5% Tacismate pH 8.0, 14% PEG 3350, 0.1M Tris pH 8.0	Resolution 3.80 Å R-free 0.262
6CH8 Crystal structure of a natively-glycosylated BG505 SOSIP.664 HIV-1 Envelope Trimer in complex with the broadly-neutralizing antibodies BG18 and 35O22 Deposited 2018-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 30–508（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；5% Tacismate pH 8.0, 15% PEG 3350	Resolution 4.10 Å R-free 0.274
6CUE Cryo-EM structure at 4.0 A resolution of vaccine-elicited antibody vFP7.04 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 2 30–502（473 aa） Chain C 30–502（473 aa） Chain c 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6CUF Cryo-EM structure at 4.2 A resolution of vaccine-elicited antibody vFP1.01 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 2 30–502（473 aa） Chain C 30–502（473 aa） Chain d 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6DE7 Crystal Structure at 4.3 A Resolution of Glycosylated HIV-1 Clade A BG505 SOSIP.664 Prefusion Env Trimer with Interdomain Stabilization 113C-429GCG in Complex with Broadly Neutralizing Antibodies PGT122 and 35O22 Deposited 2018-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 30–510（481 aa）	Mutation：D113C, T332N, R429G, A501C, E509R, K510R, A512R, V513R	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；293 K；24%PEG400, 3% PEG3350, 0.1M sodium acetate 5.5, 0.2M LiSO4	Resolution 4.12 Å R-free 0.258
6DFG BG505 MD39 SOSIP trimer in complex with mature BG18 fragment antigen binding Deposited 2018-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Chain C 30–505（476 aa） Chain D 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot time	Resolution 4.42 Å
6DFH BG505 MD64 N332-GT2 SOSIP trimer in complex with germline-reverted BG18 fragment antigen binding Deposited 2018-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Chain C 30–505（476 aa） Chain D 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；5 second blot time	Resolution 3.85 Å
6DID HIV Env BG505 SOSIP with polyclonal Fabs from immunized rabbit #3417 post-boost#1 Deposited 2018-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：GP120 domain residues 30-505 Chain F 30–505（476 aa） Fragment：GP120 domain residues 30-505 Chain G 30–505（476 aa） Fragment：GP120 domain residues 30-505	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.71 Å
6E5P Backbone model based on cryo-EM map at 8.5 A of domain-swapped, glycan-reactive, neutralizing antibody 2G12 bound to HIV-1 Env BG505 DS-SOSIP, which was also bound to CD4-binding site antibody VRC03 Deposited 2018-07-21	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 30–503（474 aa） Chain C 30–503（474 aa） Chain E 30–503（474 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.01 cryo-EM vitrification conditions Cryogen ETHANE；0.005% dodecyl maltoside was added to sample before vitification	Resolution 8.80 Å
6MAR HIV-1 Envelope Glycoprotein Clone BG505 delCT N332T in complex with broadly neutralizing antibody Fab PGT151 Deposited 2018-08-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 30–502（473 aa） Chain C 30–502（473 aa） Chain E 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6MN7 Cryo-EM structure of BG505.SOSIP.664 in complex with BF520.1 antigen binding fragment Deposited 2018-10-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 30–505（476 aa） Chain C 30–505（476 aa） Chain D 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
6MPG Cryo-EM structure at 3.2 A resolution of HIV-1 fusion peptide-directed antibody, A12V163-b.01, elicited by vaccination of Rhesus macaques, in complex with stabilized HIV-1 Env BG505 DS-SOSIP, which was also bound to antibodies VRC03 and PGT122 Deposited 2018-10-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 2 30–502（473 aa） Chain C 30–502（473 aa） Chain V 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6MPH Cryo-EM structure at 3.8 A resolution of HIV-1 fusion peptide-directed antibody, DF1W-a.01, elicited by vaccination of Rhesus macaques, in complex with stabilized HIV-1 Env BG505 DS-SOSIP, which was also bound to antibodies VRC03 and PGT122 Deposited 2018-10-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 30–502（473 aa） Chain B 30–502（473 aa） Chain C 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6MTJ Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to Small Molecule HIV-1 Entry Inhibitor BMS-378806 in Complex with Human Antibodies 3H109L and 35O22 at 2.9 Angstrom Deposited 2018-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：gp41 Chain G 30–505（476 aa） Fragment：gp120	Mutation：I559P, A605C Mutation：N137A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36 83G 1-[(2R)-4-(benzenecarbonyl)-2-methylpiperazin-1-yl]-2-(4-methoxy-1H-pyrrolo[2,3-b]pyridin-3-yl)ethane-1,2-dione × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；75mM Imidazole pH6.5 3.75% MPD 6.25% PEG 3,350 150mM LiSO4	Resolution 2.34 Å R-free 0.281
6MTN Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to Small Molecule HIV-1 Entry Inhibitor Compound 484 in Complex with Human Antibodies 3H109L and 35O22 at 3.0 Angstrom Deposited 2018-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 509–661（153 aa） Fragment：gp41 Chain G 30–505（476 aa） Fragment：gp120	Mutation：I559P, A605C Mutation：N137A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 11 JYJ {4-[1-(3-chlorophenyl)cyclopropane-1-carbonyl]piperazin-1-yl}(thiophen-3-yl)methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；60mM Imidazole pH6.5 3% MPD 5% PEG3,350 120mM LiSO$	Resolution 2.50 Å R-free 0.263
6MU6 Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to Small Molecule HIV-1 Entry Inhibitor BMS-814508 in Complex with Human Antibodies 3H109L and 35O22 at 3.2 Angstrom Deposited 2018-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：gp41 Chain G 30–505（476 aa） Fragment：gp120	Mutation：I559P, A605C Mutation：N137A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30 JYV (2R)-{1-[{7-[2-({[3-(dimethylamino)propyl](methyl)amino}methyl)-1,3-thiazol-4-yl]-4-methoxy-1H-pyrrolo[2,3-c]pyridin-3-yl}(oxo)acetyl]piperidin-4-yl}(phenyl)acetonitrile × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；60mM imidazole pH6.5 3% MPD 5% PEG3,350 120mM LiSO4	Resolution 2.55 Å R-free 0.264
6MU7 Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to Small Molecule HIV-1 Entry Inhibitor BMS-818251 in Complex with Human Antibodies 3H109L and 35O22 at 3.1 Angstrom Deposited 2018-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：gp41 Chain G 30–505（476 aa） Fragment：gp120	Mutation：I559P, A605C Mutation：N137A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36 JYY 4-{3-[{4-[(R)-cyano(phenyl)methyl]piperidin-1-yl}(oxo)acetyl]-4-methoxy-1H-pyrrolo[2,3-c]pyridin-7-yl}-N-(2-hydroxyethyl)-1,3-thiazole-2-carboxamide × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；150mM Ammonium Citrate pH7.5 7.5% PEG3,350 7.5% isopropanol	Resolution 2.50 Å R-free 0.261
6MU8 Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to Small Molecule HIV-1 Entry Inhibitor BMS-386150 in Complex with Human Antibodies 3H109L and 35O22 at 3.5 Angstrom Deposited 2018-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：gp41 Chain G 30–505（476 aa） Fragment：gp120	Mutation：I559P, A605C Mutation：N137A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33 JYS 1-[4-(benzenecarbonyl)piperazin-1-yl]-2-(4-bromo-7-fluoro-1H-indol-3-yl)ethane-1,2-dione × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；60mM imidazole pH6.5 3% MPD 5% PEG3,350 120mM LiSO4	Resolution 2.99 Å R-free 0.259
6N1V Cryo-EM structure at 4.0 A resolution of vaccine-elicited antibody A12V163-a.01 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 30–502（473 aa） Chain B 30–502（473 aa） Chain C 30–502（473 aa） Chain D 509–661（153 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6N1W Cryo-EM structure at 4.2 A resolution of vaccine-elicited antibody DFPH-a.15 in complex with HIV-1 Env BG505 DS-SOSIP, and antibodies VRC03 and PGT122 Deposited 2018-11-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 2 30–502（473 aa） Chain C 30–502（473 aa） Chain c 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6NF2 Cryo-EM structure of vaccine-elicited antibody 0PV-c.01 in complex with HIV-1 Env BG505 DS-SOSIP and antibodies VRC03 and PGT122 Deposited 2018-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 30–509（480 aa） Chain B 509–661（153 aa） Chain G 30–509（480 aa） Chain I 509–661（153 aa） Chain Q 30–509（480 aa） Chain R 509–661（153 aa）	Mutation：I201C, T332N, A433C, A501C, E509R, K510R, A512R Mutation：I559P, T605C Mutation：I201C, T332N, A433C, A501C, E509R, K510R, A512R Mutation：I559P, T605C Mutation：I201C, T332N, A433C, A501C, E509R, K510R, A512R Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6NM6 Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to N6 FR3-03 scFv in Complex with Crystallization Chaperones 3H109L Fab and 35O22 scFv at 3.2 Angstrom Deposited 2019-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 509–661（153 aa） Fragment：Ectodomain Chain G 30–505（476 aa）	Mutation：I559P, T605C Mutation：N137A, T332N, A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；60 mM acetate pH 4.5, 420 mM sodium formate, 5% PEG 3,350 and 60 mM CaCl2	Resolution 2.74 Å R-free 0.288
6NNF Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to VRC01 FR3-03 scFv in Complex with Crystallization Chaperones 3H109L Fab and 35O22 scFv at 3.5 Angstrom Deposited 2019-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 509–661（153 aa） Fragment：gp41 Chain G 30–505（476 aa） Fragment：gp120	Mutation：I559P, A605C Mutation：N137A, T332N, A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；72 mM imidazole pH 6.5, 72 mM	Resolution 2.76 Å R-free 0.298
6NNJ Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to CH31 scFv in Complex with Crystallization Chaperones 3H109L Fab and 35O22 scFv at 3.1 Angstrom Deposited 2019-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 509–661（153 aa） Fragment：gp41 Chain G 30–505（476 aa） Fragment：gp120	Mutation：I559P, A605C Mutation：N137A, T332N, A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；90 mM imidazole pH 6.5, 90 mM MgCl2, 0.6 M NaCl and 6% PEG 3,350	Resolution 2.60 Å R-free 0.293
6OPA Crystal structure of bovine Fab NC-Cow1 in complex with HIV-1 BG505 SOSIP.664, and human Fabs 35022 and PGT128 Deposited 2019-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 509–661（153 aa） Chain G 30–504（475 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.56；298 K；0.2M sodium citrate, 0.1M Tris, 30% Peg400	Resolution 4.08 Å R-free 0.343
6OSY Cryo-EM structure of vaccine-elicited antibody 0PV-a.01 in complex with HIV-1 Env BG505 DS-SOSIP and antibodies VRC03 and PGT122 Deposited 2019-05-02	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 2 30–508（479 aa） Chain B 30–508（479 aa） Chain K 30–508（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
6OT1 Cryo-EM structure of vaccine-elicited antibody 0PV-b.01 in complex with HIV-1 Env BG505 DS-SOSIP and antibodies VRC03 and PGT122 Deposited 2019-05-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 509–661（153 aa） Chain D 509–661（153 aa） Chain E 30–508（479 aa） Chain G 30–508（479 aa） Chain O 509–661（153 aa） Chain P 30–508（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6OZ4 Crystal structure of broadly neutralizing antibody N49P6 Fab in complex with HIV-1 BG505 SOSIP.664 Env trimer ectodomain. Deposited 2019-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Chain G 30–505（476 aa）	Mutation：I559P, T605C Mutation：T330N, A498C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；12% PEG 3350 0.1 M Tris-HCl pH 8.0	Resolution 4.05 Å R-free 0.315
6OZC BG505 SOSIP.664 with 2G12 Fab2 Deposited 2019-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain E 30–504（475 aa） Chain F 30–504（475 aa） Chain G 509–661（153 aa） Chain I 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.79 Å
6PW6 The HIV-1 Envelope Glycoprotein Clone BG505 SOSIP.664 in Complex with Three Copies of the Bovine Broadly Neutralizing Antibody, NC-Cow1, Fragment Antigen Binding Domain Deposited 2019-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 30–505（476 aa） Chain B 509–661（153 aa） Chain C 30–505（476 aa） Chain D 509–661（153 aa） Chain E 30–505（476 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6U0L Asymmetrically open conformational state (Class I) of HIV-1 Env trimer BG505 SOSIP.664 in complex with sCD4 and E51 Fab Deposited 2019-08-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 30–505（476 aa） Chain B 30–505（476 aa） Chain C 30–505（476 aa） Chain X 509–661（153 aa） Chain Y 509–661（153 aa） Chain Z 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6U0N Asymmetrically open conformational state (Class II) of HIV-1 Env trimer BG505 SOSIP.664 in complex with sCD4 and E51 Fab Deposited 2019-08-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 32–505（474 aa） Chain B 32–505（474 aa） Chain C 32–505（474 aa） Chain X 509–661（153 aa） Chain Y 509–661（153 aa） Chain Z 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6UDJ HIV-1 bNAb 1-18 in complex with BG505 SOSIP.664 and 10-1074 Deposited 2019-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 32–505（474 aa） Fragment：UNP residues 32-505 Chain J 32–505（474 aa） Fragment：UNP residues 32-505 Chain M 509–661（153 aa） Fragment：UNP residues 509-661 Chain P 32–505（474 aa） Fragment：UNP residues 32-505	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；0 blot force, 3.0 second blot time, 3 uL sample added to freshly glow discharged grids	Resolution 2.50 Å
6UTK Crystal structure of 438-B11 Fab in complex with an uncleaved prefusion optimized (UFO) soluble BG505 trimer and Fab 35O22 at 3.80 Angstrom Deposited 2019-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 30–503（474 aa） Fragment：UNP residues 30-503	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.2 M sodium chloride, 36% v/v PEG400, 0.1 M sodium/potassium phosphate, pH 5.7	Resolution 3.80 Å R-free 0.317
6V0R BG505 SOSIP.664 Trimer Deposited 2019-11-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 30–504（475 aa） Fragment：UNP residues 30-504 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–504（475 aa） Fragment：UNP residues 30-504 Chain D 30–504（475 aa） Fragment：UNP residues 30-504 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.87 Å
6V6W Crystal structure of antibody 438-B11 DSS mutant (Cys98A-100aA) in complex with an uncleaved prefusion optimized (UFO) soluble BG505 trimer and Fab 35O22 Deposited 2019-12-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 30–503（474 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；12% 1-propanol, 0.1M MES (pH=6.5), 20% polyethylene glycol monomethyl ether 5000, 25% glycerol	Resolution 6.50 Å R-free 0.355
6V6W Crystal structure of antibody 438-B11 DSS mutant (Cys98A-100aA) in complex with an uncleaved prefusion optimized (UFO) soluble BG505 trimer and Fab 35O22 Deposited 2019-12-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 30–503（474 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；12% 1-propanol, 0.1M MES (pH=6.5), 20% polyethylene glycol monomethyl ether 5000, 25% glycerol	Resolution 6.50 Å R-free 0.355
6V8X VRC01 Bound BG505 F14 HIV-1 SOSIP Envelope Trimer Structure Deposited 2019-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 32–502（471 aa） Fragment：UNP residues 32-502 Chain E 32–502（471 aa） Fragment：UNP residues 32-502 Chain I 32–502（471 aa） Fragment：UNP residues 32-502	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
6V8Z VRC03 and 10-1074 Bound BG505 F14 HIV-1 SOSIP Envelope Trimer Structure Deposited 2019-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 31–502（472 aa） Fragment：UNP residues 31-502 Chain G 31–502（472 aa） Fragment：UNP residues 31-502 Chain M 31–502（472 aa） Fragment：UNP residues 31-502	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6VI0 Cryo-EM structure of VRC01.23 in complex with HIV-1 Env BG505 DS.SOSIP Deposited 2020-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 30–508（479 aa） Chain F 509–661（153 aa） Chain G 30–508（479 aa） Chain I 30–508（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.43 Å
6VKN BG505 SOSIP.v5.2.N241.N289 in complex with rhesus macaque Fab RM19R Deposited 2020-01-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain C 30–504（475 aa） Chain D 30–504（475 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 39	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6VLR BG505 SOSIP.v5.2 in complex with rhesus macaque Fab RM20E1 and PGT122 Fab Deposited 2020-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain G 30–504（475 aa） Chain H 30–504（475 aa） Chain I 509–661（153 aa） Chain J 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.42 Å
6VN0 BG505 SOSIP.v4.1 in complex with rhesus macaque Fab RM20F Deposited 2020-01-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain C 30–504（475 aa） Chain D 30–504（475 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.25 Å
6VO0 BG505 SOSIP.v5.2 in complex with rabbit Fab 43A2 Deposited 2020-01-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain C 30–504（475 aa） Chain D 30–504（475 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.52 Å
6VO1 BG505 SOSIP.v5.2 in complex with rhesus macaque Fab RM20J Deposited 2020-01-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain C 30–504（475 aa） Chain D 30–504（475 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.88 Å
6W03 Crystal Structure of HIV-1 BG505 DS-SOSIP.3mut Prefusion Env Trimer in Complex with Human Antibodies 3H109L and 35O22 at 3.3 Angstrom Deposited 2020-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：ectodomain Chain G 30–504（475 aa）	Mutation：I559P, T605C Mutation：N137A, I201C, N302M, T320L, A329P, T332N, A433C, A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；75 mM imidazole pH6.5, 150 mM LiSO4, 3.8% PEG MPD and 6.2% PEG 3,350	Resolution 2.40 Å R-free 0.273
6X96 Cryo-EM model of HIV-1 Env BG505 SOSIP.664 in complex with rabbit monoclonal antibody 10A fragment antigen binding variable domain Deposited 2020-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–510（481 aa） Chain B 509–661（153 aa） Chain C 30–510（481 aa） Chain D 509–661（153 aa） Chain G 30–510（481 aa） Chain I 509–661（153 aa）	Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Detergent (DDM) added shortly prior to freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6X97 Cryo-EM model of HIV-1 Env BG505 SOSIP.664 in complex with rabbit monoclonal antibody 11A fragment antigen binding variable domain Deposited 2020-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–510（481 aa） Chain B 509–661（153 aa） Chain C 30–510（481 aa） Chain D 509–661（153 aa） Chain G 30–510（481 aa） Chain I 509–661（153 aa）	Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Detergent (DDM) added shortly prior to freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
6X98 Cryo-EM model of HIV-1 Env BG505 SOSIP.664 in complex with rabbit monoclonal antibody 11B fragment antigen binding variable domain Deposited 2020-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–510（481 aa） Chain B 509–661（153 aa） Chain C 30–510（481 aa） Chain D 509–661（153 aa） Chain G 30–510（481 aa） Chain I 509–661（153 aa）	Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, A512R, V513R Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Detergent (DDM) added shortly prior to freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
6X9R HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in HEK293F cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 51	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6X9R HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in HEK293F cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6X9R HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in HEK293F cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6X9S HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in stable CHO cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 51	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6X9S HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in stable CHO cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6X9S HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in stable CHO cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6X9T HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in HEK293S cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 51	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X9T HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in HEK293S cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X9T HIV-1 Envelope Glycoprotein BG505 SOSIP.664 expressed in HEK293S cells in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X9U HIV-1 Envelope Glycoprotein BG505 SOSIP.664, expressed in HEK293S cells and partially deglycosylated by endoglycosidase H, in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 51	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X9U HIV-1 Envelope Glycoprotein BG505 SOSIP.664, expressed in HEK293S cells and partially deglycosylated by endoglycosidase H, in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X9U HIV-1 Envelope Glycoprotein BG505 SOSIP.664, expressed in HEK293S cells and partially deglycosylated by endoglycosidase H, in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X9V HIV-1 Envelope Glycoprotein BG505 SOSIP.664, expressed in HEK293S cells and deglycosylated by endoglycosidase H, in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 51	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6X9V HIV-1 Envelope Glycoprotein BG505 SOSIP.664, expressed in HEK293S cells and deglycosylated by endoglycosidase H, in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6X9V HIV-1 Envelope Glycoprotein BG505 SOSIP.664, expressed in HEK293S cells and deglycosylated by endoglycosidase H, in complex with RM20A3 Fab Deposited 2020-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa）	Mutation：T332N,A501C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6XRT Cryo-EM structure of SHIV-elicited RHA1.V2.01 in complex with HIV-1 Env BG505 DS-SOSIP.664 Deposited 2020-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 30–505（476 aa） Chain F 30–505（476 aa） Chain G 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 40	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7KDE BG505 SOSIP.664 in complex with the V3-targeting rhesus macaque antibody 1485 and human gp120-gp41 interface antibody 8ANC195 Deposited 2020-10-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–505（474 aa） Chain F 32–505（474 aa） Chain G 32–505（474 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 34	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, blot force 0	Resolution 3.55 Å
7LG6 BG505 SOSIP.v5.2 in complex with VRC40.01 and RM19R Fabs Deposited 2021-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain E 30–504（475 aa） Chain F 30–504（475 aa） Chain G 509–661（153 aa） Chain I 509–661（153 aa）	Mutation：E64K, A73C, A316W, T332N, A501C Mutation：I559P, A561C, T605C Mutation：E64K, A73C, A316W, T332N, A501C Mutation：E64K, A73C, A316W, T332N, A501C Mutation：I559P, A561C, T605C Mutation：I559P, A561C, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.28 Å
7LL1 Cryo-EM structure of BG505 DS-SOSIP in complex with glycan276-dependent broadly neutralizing antibody VRC40.01 Fab Deposited 2021-02-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–502（473 aa） Chain C 30–502（473 aa） Chain G 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 2.5 S before plunging	Resolution 3.73 Å
7LL2 Cryo-EM structure of BG505 DS-SOSIP in complex with Glycan276-Dependent Broadly Neutralizing Antibody VRC33.01 Fab Deposited 2021-02-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–502（473 aa） Chain C 30–502（473 aa） Chain E 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 2.5 S before plunging	Resolution 3.73 Å
7LO6 Structure of CD4 mimetic BNM-III-170 in complex with BG505 SOSIP.664 HIV-1 Env trimer and 17b Fab Deposited 2021-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 32–508（477 aa） Chain B 509–661（153 aa） Chain C 32–508（477 aa） Chain D 509–661（153 aa） Chain E 32–508（477 aa） Chain F 509–661（153 aa）	Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 5VG ~{N}'-[(1~{R},2~{R})-2-(carbamimidamidomethyl)-5-(methylaminomethyl)-2,3-dihydro-1~{H}-inden-1-yl]-~{N}-(4-chloranyl-3-fluoranyl-phenyl)ethanediamide × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7LOK Structure of CD4 mimetic M48U1 in complex with BG505 SOSIP.664 HIV-1 Env trimer and 17b Fab Deposited 2021-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: tridecameric	Chain A 32–508（477 aa） Chain B 509–661（153 aa） Chain C 32–508（477 aa） Chain D 509–661（153 aa） Chain E 32–508（477 aa） Chain F 509–661（153 aa）	Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664 Mutation：BG505 SOSIP.664	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7LPN Cryo-EM structure of llama J3 VHH antibody in complex with HIV-1 Env BG505 DS-SOSIP.664 Deposited 2021-02-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 30–505（476 aa） Chain E 509–661（153 aa） Chain F 30–505（476 aa） Chain G 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.61 Å
7MDT BG505 SOSIP.v5.2 in complex with the monoclonal antibody Rh4O9.8 (as Fab fragment) Deposited 2021-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–508（479 aa） Chain B 509–661（153 aa） Chain C 30–508（479 aa） Chain D 509–661（153 aa） Chain E 30–508（479 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；TBS, 0.2um filtered cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7MDU BG505 SOSIP MD39 in complex with the monoclonal antibodies Rh.33104 mAb.1 and RM20A3 Deposited 2021-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 30–508（479 aa） Chain B 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；TBS, 0.2um filtered cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 0 Wait time: 10s Blot time: 3-7s	Resolution 3.30 Å
7MXE Ab1245 Fab in complex with BG505 SOSIP.664 and 8ANC195 Fab Deposited 2021-05-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain C 509–661（153 aa） Chain D 509–661（153 aa） Chain F 509–661（153 aa） Chain G 32–508（477 aa） Chain J 32–508（477 aa） Chain P 32–508（477 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 23	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；0 blot force, 3 second blot time, 3 uL sample added	Resolution 3.70 Å
7RAI Cryo-EM structure of M4008_N1 Fab in complex with BG505 DS-SOSIP.664 Env trimer Deposited 2021-07-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Chain B 509–661（153 aa） Chain C 30–505（476 aa） Chain D 509–661（153 aa） Chain E 30–505（476 aa） Chain F 509–661（153 aa）	Mutation：I200C, T330N, A430C, A498C Mutation：I556P, T602C Mutation：I200C, T330N, A430C, A498C Mutation：I556P, T602C Mutation：I200C, T330N, A430C, A498C Mutation：I556P, T602C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.24 Å
7SQ1 BG505.MD39TS Env trimer in complex with Fab from antibody C05 Deposited 2021-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain B 509–661（153 aa） Chain C 31–502（472 aa） Chain D 509–661（153 aa） Chain E 31–502（472 aa） Chain F 509–661（153 aa） Chain G 31–502（472 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 41	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7T9B ApexGT5 in complex with GT5-d42.16 and RM20A3 Fabs Deposited 2021-12-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain B 509–661（153 aa） Chain D 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 41	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.72 Å
7TFN Cryo-EM structure of CD4bs antibody Ab1303 in complex with HIV-1 Env trimer BG505 SOSIP.664 Deposited 2022-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain X 509–661（153 aa） Fragment：UNP residues 509-661 Chain Y 509–661（153 aa） Fragment：UNP residues 509-661 Chain Z 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 MAN alpha-D-mannopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
7TFO Cryo-EM structure of HIV-1 Env trimer BG505 SOSIP.664 in complex with CD4bs antibody Ab1573 Deposited 2022-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain X 509–661（153 aa） Fragment：UNP residues 509-661 Chain Y 509–661（153 aa） Fragment：UNP residues 509-661 Chain Z 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7TXD Cryo-EM structure of BG505 SOSIP HIV-1 Env trimer in complex with CD4 receptor (D1D2) and broadly neutralizing darpin bnD.9 Deposited 2022-02-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–505（476 aa） Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–505（476 aa） Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–505（476 aa） Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.87 Å
7UCF Structure of the BG505 SOSIP.664 trimer in complex with neutralizing antibody Fab fragments 10-1074 and BG24 Deposited 2022-03-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 29–505（477 aa） Fragment：UNP residues 29-505	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 FUC alpha-L-fucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；0.1 M Bis-Tris pH 6.5, 20% PEG1500	Resolution 4.00 Å R-free 0.277
7UOJ The CryoEM structure of N49-P9.6-FR3 and PGT121 Fabs in complex with BG505 SOSIP.664 Deposited 2022-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 30–505（476 aa） Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 30–505（476 aa） Chain I 30–505（476 aa） Chain J 509–661（153 aa） Fragment：UNP residues 509-661	Mutation：T330N,A498C Mutation：I556P,T602C Mutation：I556P,T602C Mutation：T330N,A498C Mutation：T330N,A498C Mutation：I556P,T602C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；Phosphate buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.02 Å
8DP1 Cryo-EM structure of HIV-1 Env(BG505.T332N SOSIP) in complex with DH1030.1 Fab Deposited 2022-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 30–505（476 aa） Fragment：gp120 Chain H 509–661（153 aa） Fragment：UNP residues 509-661 Chain J 30–505（476 aa） Fragment：gp120 Chain Q 509–661（153 aa） Fragment：UNP residues 509-661 Chain S 509–661（153 aa） Fragment：UNP residues 509-661 Chain W 30–505（476 aa） Fragment：gp120	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
8E1P Crystal structure of BG505 SOSIP.v4.1-GT1.2 trimer in complex with gl-PGV20 and PGT124 Fabs Deposited 2022-08-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain X 509–661（153 aa） Fragment：UNP residues 509-661 Chain Y 509–661（153 aa） Fragment：UNP residues 509-661 Chain Z 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.2 M ammonium sulfate, 0.1 M Tris, pH 8.5, 12% w/v PEG8000	Resolution 3.82 Å R-free 0.301
8EUU Cryo-EM structure of HIV-1 BG505 DS-SOSIP ENV trimer bound to VRC34.01 FAB Deposited 2022-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–510（481 aa） Fragment：UNP residues 30-510 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–510（481 aa） Fragment：UNP residues 30-510 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–510（481 aa） Fragment：UNP residues 30-510 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8EUV Cryo-EM structure of HIV-1 BG505 DS-SOSIP ENV trimer bound to VRC34.01-COMBO1 FAB Deposited 2022-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–510（481 aa） Fragment：UNP residues 30-510 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–510（481 aa） Fragment：UNP residues 30-510 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–510（481 aa） Fragment：UNP residues 30-510 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8EUW Cryo-EM structure of HIV-1 BG505 DS-SOSIP ENV trimer bound to VRC34.01-MM28 FAB Deposited 2022-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 30–510（481 aa） Fragment：UNP residues 30-510 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–510（481 aa） Fragment：UNP residues 30-510 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–510（481 aa） Fragment：UNP residues 30-510 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8FIS Structure of Bispecific CAP256V2LS-J3 Fab in complex with BG505 DS-SOSIP.664 Deposited 2022-12-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 509–661（153 aa） Fragment：UNP residues 509-661 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–510（481 aa） Fragment：UNP residues 30-510 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 30–510（481 aa） Fragment：UNP residues 30-510 Chain G 30–510（481 aa） Fragment：UNP residues 30-510	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 25	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
8FK5 Cryo-EM Structure of PG9RSH DU011 Fab in complex with BG505 DS-SOSIP.664 Deposited 2022-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 509–661（153 aa） Fragment：UNP residues 509-661 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–510（481 aa） Fragment：UNP residues 30-510 Chain F 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 30–510（481 aa） Fragment：UNP residues 30-510 Chain I 30–510（481 aa） Fragment：UNP residues 30-510	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 38	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8FL1 Cryo-EM Structure of PG9RSH DU025 Fab in complex with BG505 DS-SOSIP.664 Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 509–661（153 aa） Fragment：UNP residues 509-661 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–510（481 aa） Fragment：UNP residues 30-510 Chain F 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 30–510（481 aa） Fragment：UNP residues 30-510 Chain I 30–510（481 aa） Fragment：UNP residues 30-510	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 40	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.75 Å
8FLW Cryo-EM Structure of PGT145 DU303 Fab in complex with BG505 DS-SOSIP.664 Deposited 2022-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 509–661（153 aa） Fragment：UNP residues 509-661 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–510（481 aa） Fragment：UNP residues 30-510 Chain F 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 30–510（481 aa） Fragment：UNP residues 30-510 Chain I 30–510（481 aa） Fragment：UNP residues 30-510	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 35	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.58 Å
8FR6 Antibody vFP53.02 in complex with HIV-1 envelope trimer BG505 DS-SOSIP Deposited 2023-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 30–502（473 aa） Chain G 30–502（473 aa） Chain I 30–502（473 aa）	Mutation：BG505 DS-SOSIP construct Mutation：BG505 DS-SOSIP construct Mutation：BG505 DS-SOSIP construct	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8FYJ Structure of HIV-1 BG505 SOSIP-HT2 in complex with two CD4 molecules (class I) Deposited 2023-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain D 509–661（153 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8G4M Vaccine-elicited human antibody 2C06 in complex with HIV-1 envelope trimer BG505 DS-SOSIP Deposited 2023-02-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 30–502（473 aa） Chain G 30–502（473 aa） Chain I 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS + 0.005%(w/v) DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
8G4T Vaccine-elicited human antibody 2C09 in complex with HIV-1 envelope trimer BG505 DS-SOSIP Deposited 2023-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 30–502（473 aa） Chain G 30–502（473 aa） Chain I 30–502（473 aa）	Mutation：BG505 DS-SOSIP mutations Mutation：BG505 DS-SOSIP mutations Mutation：BG505 DS-SOSIP mutations	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS + 0.1mM DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
8G85 vFP52.02 Fab in complex with BG505 DS-SOSIP Env trimer Deposited 2023-02-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 30–510（481 aa） Fragment：UNP residues 30-510 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 30–510（481 aa） Fragment：UNP residues 30-510 Chain J 30–510（481 aa） Fragment：UNP residues 30-510 Chain K 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 35	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.99 Å
8G9W Cryo-EM structure of vFP49.02 Fab in complex with HIV-1 Env BG505 DS-SOSIP.664 (conformation 1) Deposited 2023-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–510（481 aa） Fragment：UNP residues 30-510 Chain G 30–510（481 aa） Fragment：UNP residues 30-510 Chain O 509–661（153 aa） Fragment：UNP residues 509-661 Chain P 30–510（481 aa） Fragment：UNP residues 30-510	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.66 Å
8G9X Cryo-EM structure of vFP49.02 Fab in complex with HIV-1 Env BG505 DS-SOSIP.664 (conformation 2) Deposited 2023-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–510（481 aa） Fragment：UNP residues 30-510 Chain G 30–510（481 aa） Fragment：UNP residues 30-510 Chain O 509–661（153 aa） Fragment：UNP residues 509-661 Chain P 30–510（481 aa） Fragment：UNP residues 30-510	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.46 Å
8G9Y Cryo-EM structure of vFP49.02 Fab in complex with HIV-1 Env BG505 DS-SOSIP.664 (conformation 3) Deposited 2023-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–510（481 aa） Fragment：UNP residues 30-510 Chain G 30–510（481 aa） Fragment：UNP residues 30-510 Chain O 509–661（153 aa） Fragment：UNP residues 509-661 Chain P 30–510（481 aa） Fragment：UNP residues 30-510	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.28 Å
8GAS vFP48.02 Fab in complex with BG505 DS-SOSIP Env trimer Deposited 2023-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain D 30–505（476 aa） Fragment：UNP residues 30-505 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 30–505（476 aa） Fragment：UNP residues 30-505 Chain J 30–505（476 aa） Fragment：UNP residues 30-505 Chain K 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.04 Å
8SW3 BG505 GT1.1 SOSIP in complex with NHP Fabs 12C11 and RM20A3 Deposited 2023-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Mutation：I559P, T605C Mutation：I559P, T605C Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Detergent added shortly before freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8SW4 BG505 GT1.1 SOSIP in complex with NHP Fabs 21N13, 21M20 and RM20A3 Deposited 2023-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 20 PDB declaration: eicosameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 509–661（153 aa） Fragment：UNP residues 509-661 Chain I 509–661（153 aa） Fragment：UNP residues 509-661	Mutation：I559P, T605C Mutation：I559P, T605C Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Detergent added shortly before freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
8TGO Crystal structure of the BG505 triple tandem trimer gp140 HIV-1 Env in complex with PGT124 and 35O22 Deposited 2023-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain G 30–504（475 aa） Fragment：UNP residues 30-504 Chain H 509–661（153 aa） Fragment：UNP residues 509-661 Chain R 30–504（475 aa） Fragment：UNP residues 30-504 Chain a 509–661（153 aa） Fragment：UNP residues 509-661 Chain e 30–504（475 aa） Fragment：UNP residues 30-504	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；0.1 M sodium acetate, 0.2 M zinc acetate, 11.5 % w/v PEG3000, pH 4.83	Resolution 5.75 Å R-free 0.292
8TJR CRYO-EM STRUCTURE OF HIV-1 BG505DS-SOSIP.664 ENV TRIMER BOUND TO HERH-a.01 FAB Deposited 2023-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 30–504（475 aa） Chain B 30–504（475 aa） Chain C 30–504（475 aa） Chain D 509–661（153 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 48	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
8TJS CRYO-EM STRUCTURE OF HIV-1 BG505DS-SOSIP.664 ENV TRIMER BOUND TO GPZ6-a.01 FAB Deposited 2023-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain B 509–661（153 aa） Chain G 30–502（473 aa） Chain H 509–661（153 aa） Chain I 509–661（153 aa） Chain N 30–502（473 aa） Chain O 30–502（473 aa）	Mutation：I556P, T602C Mutation：I556P, T602C Mutation：I556P, T602C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 48	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.31 Å
8TNG Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with broadly neutralizing llama nanobody R27 targeting the CD4-binding site Deposited 2023-08-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–505（476 aa） Fragment：UNP residues 30-505 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.58 Å
8TNH Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with broadly neutralizing llama nanobody G36 targeting the CD4-binding site Deposited 2023-08-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–505（476 aa） Fragment：UNP residues 30-505 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8TNI Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with broadly neutralizing bi-specific antibody CAP256L-R27 targeting the CD4-binding site and the V2-apex Deposited 2023-08-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–505（476 aa） Fragment：UNP residues 30-505 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 32	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.61 Å
8TOP Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with antibody GPZ6-b.01 targeting the fusion peptide Deposited 2023-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 509–661（153 aa） Fragment：UNP residues 509-661 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 30–505（476 aa） Fragment：UNP residues 30-505 Chain F 509–661（153 aa） Fragment：UNP residues 509-661 Chain O 30–505（476 aa） Fragment：UNP residues 30-505 Chain P 509–661（153 aa） Fragment：UNP residues 509-661 Chain Q 30–505（476 aa） Fragment：UNP residues 30-505 Chain R 509–661（153 aa） Fragment：UNP residues 509-661 Chain S 30–505（476 aa） Fragment：UNP residues 30-505 Chain T 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 82	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, and 1.8 mM KH2PO4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.52 Å
8TOX Cryo-EM structure of BG505 Env mutant A517E in complex with antibody ACS202 Fab Deposited 2023-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 30–504（475 aa） Chain F 509–661（153 aa） Chain G 30–504（475 aa） Chain I 30–504（475 aa）	Mutation：A517E, M535N, N543Q, T569G, I573F, R588E, D589V, S636G, N651F, K655I Mutation：A517E, M535N, N543Q, T569G, I573F, R588E, D589V, S636G, N651F, K655I Mutation：A517E, M535N, N543Q, T569G, I573F, R588E, D589V, S636G, N651F, K655I	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS with 0.1 mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.30 Å
8TQ1 HIV-1 BG505 Env SOSIP in complex with bovine Fab Bess4 and non-human primate Fab RM20A3 Deposited 2023-08-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: 13-meric	Chain A 30–505（476 aa） Chain E 30–505（476 aa） Chain J 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 45	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8TTW Cryo-EM structure of BG505 SOSIP.664 HIV-1 Env trimer in complex with temsavir, 8ANC195, and 10-1074 Deposited 2023-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 30–510（481 aa） Chain E 30–510（481 aa） Chain I 30–510（481 aa）	Mutation：A501C T332N E509R K510R A512R V513R Mutation：A501C T332N E509R K510R A512R V513R Mutation：A501C T332N E509R K510R A512R V513R	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21 83J 1-[4-(benzenecarbonyl)piperazin-1-yl]-2-[4-methoxy-7-(3-methyl-1H-1,2,4-triazol-1-yl)-1H-pyrrolo[2,3-c]pyridin-3-yl]ethane-1,2-dione × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.96 Å
8ULR Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 05_B08 Fabs Deposited 2023-10-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 32–501（470 aa） Chain C 32–501（470 aa） Chain E 32–501（470 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 3.30 Å
8ULS Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 01_D03 Fabs Deposited 2023-10-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 32–501（470 aa） Chain C 32–501（470 aa） Chain E 32–501（470 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 3.20 Å
8ULT Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 04_A06 Fabs Deposited 2023-10-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 32–501（470 aa） Chain C 32–501（470 aa） Chain E 32–501（470 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 29	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 3.80 Å
8ULU Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 04_A06 and PGDM1400 Fabs Deposited 2023-10-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: 14-meric	Chain A 32–501（470 aa） Chain C 32–501（470 aa） Chain E 32–501（470 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 3.80 Å
8VFV HIV Env BG505_MD39_B16 SOSIP boosting trimer in complex with B16_d77.5 mouse Fab and RM20A3 Fab Deposited 2023-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 30–510（481 aa） Chain B 509–661（153 aa） Chain E 30–510（481 aa） Chain F 509–661（153 aa） Chain J 30–510（481 aa） Chain K 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9AUG Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3.G57R Deposited 2024-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 30–495（466 aa） Fragment：d949.GS-gp120 Chain B 30–495（466 aa） Fragment：d949.GS-gp120 Chain C 30–495（466 aa） Fragment：d949.GS-gp120 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9AUH Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3 Deposited 2024-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 30–495（466 aa） Fragment：d949.GS-gp120 Chain B 30–495（466 aa） Fragment：d949.GS-gp120 Chain C 30–495（466 aa） Fragment：d949.GS-gp120 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9AUI Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA4 Deposited 2024-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 30–495（466 aa） Fragment：d949.GS-gp120 Chain B 30–495（466 aa） Fragment：d949.GS-gp120 Chain C 30–495（466 aa） Fragment：d949.GS-gp120 Chain D 509–661（153 aa） Fragment：UNP residues 509-661 Chain E 509–661（153 aa） Fragment：UNP residues 509-661 Chain F 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9AXD HIV BG505.v5.2 (N289/N241) SOSIP Env in Complex with gp120-Interface pAb from Rh.33203 Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–508（479 aa） Chain B 507–661（155 aa） Chain C 30–508（479 aa） Chain D 507–661（155 aa） Chain E 30–508（479 aa） Chain F 507–661（155 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 40	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9AY6 HIV BG505.v5.2 (N289/N241) SOSIP Env in Complex with V5 pAb from Rh.33203 Deposited 2024-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–508（479 aa） Chain B 507–661（155 aa） Chain C 30–508（479 aa） Chain D 507–661（155 aa） Chain E 30–508（479 aa） Chain F 507–661（155 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
9AYS HIV BG505.v5.2 (N289/N241) SOSIP Env in Complex with V5, gp120-Interface, and Anti-Immune Complex pAbs from Rh.33203 Deposited 2024-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 30–508（479 aa） Chain B 507–661（155 aa） Chain C 30–508（479 aa） Chain D 507–661（155 aa） Chain E 30–508（479 aa） Chain F 507–661（155 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 43	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
9AYV HIV CH505/BG505 SOSIP.v8.1 Env in Complex with V1/V3 Epitope and Anti-Immune Complex pAbs from Rabbit 2474 Deposited 2024-03-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain B 507–661（155 aa） Chain D 507–661（155 aa） Chain F 507–661（155 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 38	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
9B8B RM038 Fab in complex with Apex-GT 6.2 trimer and RM20A3 Fab Deposited 2024-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 30–505（476 aa） Chain B 509–661（153 aa） Chain C 30–505（476 aa） Chain D 30–505（476 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 49	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9B8C RM018 Fab in complex with Apex GT 6.2 trimer and RM20A3 Fab Deposited 2024-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 30–504（475 aa） Chain B 509–661（153 aa） Chain C 30–504（475 aa） Chain D 30–504（475 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 48	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9BNK Cryo-EM structure of rhesus antibody V031-a.01 in complex with HIV-1 Env BG505 DS-SOSIP Deposited 2024-05-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 515–661（147 aa） Chain B 515–661（147 aa） Chain C 515–661（147 aa） Chain E 31–503（473 aa） Chain F 31–503（473 aa） Chain G 31–503（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 39	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9BNM Cryo-EM structure of rhesus antibody 44715-a.01 in complex with HIV-1 Env BG505 DS-SOSIP Deposited 2024-05-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–505（476 aa） Chain B 30–505（476 aa） Chain C 30–505（476 aa） Chain X 510–661（152 aa） Chain Y 510–661（152 aa） Chain Z 510–661（152 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 19	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.97 Å
9BNP Cryo-EM structure of rhesus antibody V033-a.01 in complex with HIV-1 Env BG505 DS-SOSIP Deposited 2024-05-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 32–502（471 aa） Chain B 517–661（145 aa） Chain E 32–502（471 aa） Chain F 517–661（145 aa） Chain I 32–502（471 aa） Chain J 517–661（145 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9BTL Cryo-EM structure of rhesus antibody 41328-a.01 in complex with HIV-1 Env BG505 DS-SOSIP Deposited 2024-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–505（476 aa） Chain B 510–661（152 aa） Chain E 30–505（476 aa） Chain F 510–661（152 aa） Chain I 30–505（476 aa） Chain J 510–661（152 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.96 Å
9CF5 STRUCTURE OF CD4 MIMETIC CJF-III-288 IN COMPLEX WITH BG505 SOSIP.664 HIV-1ENV TRIMER AND 17B FAB Deposited 2024-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 32–508（477 aa） Chain B 509–661（153 aa） Fragment：residues 512-664 (509-661 Uniprot numbering) Chain C 32–508（477 aa） Chain D 509–661（153 aa） Fragment：residues 512-664 (509-661 Uniprot numbering) Chain E 32–508（477 aa） Chain F 509–661（153 aa） Fragment：residues 512-664 (509-661 Uniprot numbering)	Mutation：T332N, A501C, E509R, K510R, insertion of RR after residue 511 Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, insertion of RR after residue 511 Mutation：I559P, T605C Mutation：T332N, A501C, E509R, K510R, insertion of RR after residue 511 Mutation：I559P, T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 26 Y26 propyl (2R,3S)-2-(carbamimidamidomethyl)-3-[2-(4-chloro-3-fluoroanilino)(oxo)acetamido]-6-[(methylamino)methyl]-2,3-dihydro-1H-indole-1-carboxylate × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9D1W Cryo-EM structure of PGDM1400 Fab bound to HIV-1 BG505 DS-SOSIP.664 Env trimer Deposited 2024-08-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 30–505（476 aa） Fragment：UNP residues 30-505 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain a 509–661（153 aa） Fragment：UNP residues 509-661 Chain b 509–661（153 aa） Fragment：UNP residues 509-661 Chain c 509–661（153 aa） Fragment：UNP residues 509-661	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9D3D Cryo-EM structure of PGT145 R100aS Fab bound to HIV-1 BG505 DS-SOSIP.664 Env trimer Deposited 2024-08-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain B 30–505（476 aa） Fragment：UNP residues 30-505 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain a 509–661（153 aa） Fragment：residues 512-664 Chain b 509–661（153 aa） Fragment：residues 512-664 Chain c 509–661（153 aa） Fragment：residues 512-664	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24 PO4 PHOSPHATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
9D8Y Cryo-EM structure of HIV-1 BG505 SOSIP.664 Env bound to 3-sCD4, 3-VRC34.01 Fab with one gp120 rotated, Population 4 Deposited 2024-08-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain D 509–661（153 aa） Fragment：UNP residues 509-611 Chain E 509–661（153 aa） Fragment：UNP residues 509-611 Chain F 509–661（153 aa） Fragment：UNP residues 509-611	Mutation：I559P,T605C Mutation：I559P,T605C Mutation：I559P,T605C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.06 Å
9DMB Rhesus RHA10.01 Fab in complex with HIV-1 Env BG505 DS-SOSIP trimer Deposited 2024-09-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain F 30–509（480 aa） Chain K 30–509（480 aa） Chain L 30–509（480 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.27 Å
9MI0 61-12A01 Fab in complex with HIV-1 GT1.1 v4.1 SOSIP Env trimer and RM20A3 Fab Deposited 2024-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-611 Chain D 509–661（153 aa） Fragment：UNP residues 509-611 Chain F 509–661（153 aa） Fragment：UNP residues 509-611	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9MIA 206-3G08 Fab in complex with HIV-1 GT1.1 v4.1 SOSIP Env trimer and RM20A3 Fab Deposited 2024-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 509–661（153 aa） Fragment：UNP residues 509-611 Chain D 509–661（153 aa） Fragment：UNP residues 509-611 Chain F 509–661（153 aa） Fragment：UNP residues 509-611	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9MIB 206-9C09 Fab in complex with HIV-1 GT1.1 v4.1 SOSIP Env trimer and RM20A3 Fab Deposited 2024-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 18-meric	Chain B 509–661（153 aa） Fragment：UNP residues 509-611 Chain D 509–661（153 aa） Fragment：UNP residues 509-611 Chain F 509–661（153 aa） Fragment：UNP residues 509-611	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9MIH 273-4D01 Fab in complex with HIV-1 BG505 SOSIP Env trimer and RM20A3 Fab Deposited 2024-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: 14-meric	Chain A 30–505（476 aa） Chain B 509–661（153 aa） Chain C 30–505（476 aa） Chain D 509–661（153 aa） Chain E 30–505（476 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 44	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9MII 253-7A03 Fab in complex with HIV-1 BG505 SOSIP Env trimer and RM20A3 Fab Deposited 2024-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: 14-meric	Chain A 30–505（476 aa） Chain B 509–661（153 aa） Chain C 30–505（476 aa） Chain D 509–661（153 aa） Chain E 30–505（476 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 44	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9MQG RM017 Fab in complex with Apex-GT6.2 trimer and RM20A3 Fab Deposited 2025-01-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain B 509–661（153 aa） Chain E 509–661（153 aa） Chain F 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 39	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9O2Q BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 0 (unbound) Deposited 2025-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 32–507（476 aa） Chain B 508–661（154 aa） Chain C 32–507（476 aa） Chain D 508–661（154 aa） Chain E 32–507（476 aa） Chain F 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 2.90 Å
9O2R BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 1 (1 Fab bound) Deposited 2025-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 32–507（476 aa） Chain B 508–661（154 aa） Chain C 32–507（476 aa） Chain D 508–661（154 aa） Chain E 32–507（476 aa） Chain F 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 3.00 Å
9O2S BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 2 (2 Fabs bound) Deposited 2025-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 32–507（476 aa） Chain B 508–661（154 aa） Chain C 32–507（476 aa） Chain D 508–661（154 aa） Chain E 32–507（476 aa） Chain F 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 23	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 3.20 Å
9O2T BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 3 (3 Fabs bound) Deposited 2025-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 32–507（476 aa） Chain B 508–661（154 aa） Chain C 32–507（476 aa） Chain D 508–661（154 aa） Chain E 32–507（476 aa） Chain F 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 0 blot force	Resolution 3.40 Å
9O2U BG505 SOSIP in complex with 007 bNAb IgG1 - trimer-dimer class Deposited 2025-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 32–507（476 aa） Chain B 508–661（154 aa） Chain C 32–507（476 aa） Chain D 508–661（154 aa） Chain E 32–507（476 aa） Chain F 508–661（154 aa） Chain O 32–507（476 aa） Chain P 508–661（154 aa） Chain Q 32–507（476 aa） Chain R 508–661（154 aa） Chain S 32–507（476 aa） Chain T 508–661（154 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 48	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9O8M Ab1983 in complex with HIV-1 Env variant WIN332 Deposited 2025-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain E 32–510（479 aa） Chain F 509–661（153 aa） Chain I 32–510（479 aa） Chain J 509–661（153 aa） Chain K 32–510（479 aa） Chain L 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.79 Å
9OED Ab1999 in complex with HIV-1 Env RC1 Deposited 2025-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain D 509–661（153 aa） Chain F 509–661（153 aa） Chain J 509–661（153 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 23	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6；1X PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.94 Å
9OGM BG505 MD39.3 Env gp151 MPER nanodisc in complex with 10E8, BG18 and VRC01 Fabs (1x 10E8 Fab) Deposited 2025-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 17 PDB declaration: 17-meric	Chain A 30–504（475 aa） Chain B 30–504（475 aa） Chain C 30–504（475 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9OGT HIV-1 Env BG505 SOSIP.664-His in complex with PGT122 and 3BNC117 Fabs Deposited 2025-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 18-meric	Chain A 30–505（476 aa） Chain C 30–505（476 aa） Chain E 30–505（476 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9OGU HIV-1 Env BG505 SOSIP.664-dPG-His in complex with PGT122 and 3BNC117 Fabs Deposited 2025-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 18-meric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain E 30–505（476 aa） Fragment：UNP residues 30-505	Mutation：T332N, A501C Mutation：T332N, A501C Mutation：T332N, A501C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9P6E N49P7-FR Fab in complex with BG505 MD39 SOSIP and RM20A3 Fab Deposited 2025-06-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 18-meric	Chain B 509–661（153 aa） Chain D 509–661（153 aa） Chain F 509–661（153 aa）	Mutation：F516S, I556P, S558P, L565D, V567H, R582H, T602C Mutation：F516S, I556P, S558P, L565D, V567H, R582H, T602C Mutation：F516S, I556P, S558P, L565D, V567H, R582H, T602C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 5.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9P6G eN49P7-FRv1-23 Fab in complex with BG505 MD39 SOSIP and RM20A3 Fab Deposited 2025-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 18-meric	Chain B 509–661（153 aa） Chain D 509–661（153 aa） Chain F 509–661（153 aa）	Mutation：F516S, I556P, S558P, L565D, V567H, R582H, T602C Mutation：F516S, I556P, S558P, L565D, V567H, R582H, T602C Mutation：F516S, I556P, S558P, L565D, V567H, R582H, T602C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 5.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9PNI Cryo-EM structure of J601-1B2 Fab in complex with HIV-1 BG505 DS-SOSIP Env trimer Deposited 2025-07-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain C 30–502（473 aa） Chain G 30–502（473 aa） Chain I 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 19 MAN alpha-D-mannopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS buffer supplemented with 0.1 mM DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.83 Å
9PNN Cryo-EM structure of J601-A6 Fab in complex with HIV-1 BG505 DS-SOSIP Env trimer Deposited 2025-07-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain C 30–502（473 aa） Chain G 30–502（473 aa） Chain I 30–502（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS + 0.005% (w/v) DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9Q0W Cryo-EM Structure of HIV-1 BG505DS-SOSIP.664 Env Trimer Bound to DFPH-a.01_10R59P_LC Fab Deposited 2025-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 30–505（476 aa） Fragment：UNP residues 30-505 Chain C 30–505（476 aa） Fragment：UNP residues 30-505 Chain E 30–505（476 aa） Fragment：UNP residues 30-505	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9YHO AJ09-21 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YHQ AJ09-83 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 45	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9YHR AJ09-110 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9YHS AM12-340 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.30 Å
9YHT AM12-347 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
9YIB AM12-351 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
9YID AM12-352 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
9YIE NN39-25 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
9YIF NN39-171 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9YIG V634-136 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 48	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9YIH V634-136 UCA Fab in complex with HIV-1 Env del4-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YII V645-158 Fab in complex with HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YIJ HIV-1 Env 5MUT-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
9YIK HIV-1 Env del4-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–508（477 aa） Chain F 32–508（477 aa） Chain G 32–508（477 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9YIL HIV-1 Env del8-3fill SOSIP Deposited 2025-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 509–661（153 aa） Chain B 509–661（153 aa） Chain C 509–661（153 aa） Chain E 32–510（479 aa） Chain F 32–510（479 aa） Chain G 32–510（479 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 8；150 mM NaCl, 20 mM Tris-HCl, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.00 Å

186 other PDB entries and 199 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q2N0S6_9HIV1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–479； UniProt 30–508 Author chain G； PDBConstruct 1–479； UniProt 30–508 Author chain H； PDBConstruct 1–479； UniProt 30–508

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6chb
Deposition date deposition_date	2018-02-22
Structure title title	Crystal structure of a natively-glycosylated BG505 SOSIP.664 HIV-1 Envelope Trimer in complex with the broadly-neutralizing antibodies BG18 and IOMA
Keywords keywords	Env glycoprotein, broadly neutralizing antibodies, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	62.31 Å
Radius of gyration Rg (electron density) rg_electron	62.43 Å
Forward intensity I(0) i0	2461240000.00
Molecular weight molecular_weight	409260.0 kDa
Excluded volume excluded_volume	509160 Å³
Envelope volume envelope_volume	803200 Å³
Hydration-shell volume shell_volume	111300 Å³
Envelope diameter envelope_diameter	199.0 Å
Shell Rg shell_rg	59.83 Å
Envelope Rg envelope_rg	62.50 Å
Shape Rg shape_rg	62.43 Å
Total Rg total_rg	62.37 Å
Total atoms total_atoms	28753
Residues n_residues	3671
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	208.8 Å
Rg (real space) rg_real	62.32 Å
Rg uncertainty (real space) rg_real_error	1.65 Å
I(0) (real space) i0_real	2.4610e+09
I(0) uncertainty (real space) i0_real_error	4.7310e+07
Rg (reciprocal space) rg_reciprocal	62.26 Å
I(0) (reciprocal space) i0_reciprocal	2461000000.0000
Solution quality estimate total_estimate	0.8230
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	75.2 Å
Skewness Skewness skewness	0.273
Kurtosis Kurtosis kurtosis	-0.560
Angular range angular_range	— – 0.1250 Å⁻¹
Current regularization parameter α current_alpha	0.0020
Highest regularization parameter α highest_alpha	116100000.0000
Real-space data points n_real_points	26
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.900; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Envelope glycoprotein gp41
Molecular weight formula_weight	17162.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A,C
Atom count atom_count	28753

AVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAIEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD

来源 Source

来源生物 organism	Human immunodeficiency virus 1
NCBI Class编号 ncbi_taxonomy_id	11676
宿主生物 host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	Envelope glycoprotein gp120
Molecular weight formula_weight	53693.8 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,F,H

AENLWVTVYYGVPVWKDAETTLFCASDAKAYETEKHNVWATHACVPTDPNPQEIHLENVTEEFNMWKNNMVEQMHTDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGELKNCSFNMTTELRDKKQKVYSLFYRLDVVQINENQGNRSNNSNKEYRLINCNTSAITQACPKVSFEPIPIHYCAPAGFAILKCKDKKFNGTGPCPSVSTVQCTHGIKPVVSTQLLLNGSLAEEEVMIRSENITNNAKNILVQFNTPVQINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNVSKATWNETLGKVVKQLRKHFGNNTIIRFANSSGGDLEVTTHSFNCGGEFFYCNTSGLFNSTWISNTSVQGSNSTGSNDSITLPCRIKQIINMWQRIGQAMYAPPIQGVIRCVSNITGLILTRDGGSTNSTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRRVVGREKR

来源 Source

来源生物 organism	Human immunodeficiency virus 1
NCBI Class编号 ncbi_taxonomy_id	11676
宿主生物 host_organism	Cricetulus griseus

Entity 3 Entity 3 polymer

Description description	BG18 Heavy Chain
Molecular weight formula_weight	26158.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,I,Q

QVQLRESGPGLVKPSETLSLSCTVSQDSRPSDHSWTWVRQSPGKALEWIGDIHYNGATTYNPSLRSRVRIELDQSIPRFSLKMTSMTAADTGMYYCARNAIRIYGVVALGEWFHYGMDVWGQGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	BG18 Light Chain
Molecular weight formula_weight	23021.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,R

WASSELTQPPSVSVSPGQTARITCSGAPLTSRFTYWYRQKPGQAPVLIISRSSQRSSGWSGRFSASWSGTTVTLTIRGVQADDEADYYCQSSDTSDSYKMFGGGTKLTVLGQPAAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	IOMA Heavy Chain
Molecular weight formula_weight	25176.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,M,O

EVQLVESGAQVKKPGASVTVSCTASGYKFTGYHMHWVRQAPGRGLEWMGWINPFRGAVKYPQNFRGRVSMTRDTSMEIFYMELSRLTSDDTAVYYCAREMFDSSADWSPWRGMVAWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKT

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	IOMA Light Chain
Molecular weight formula_weight	22592.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,N,P

QSALTQPASVSGSPGQSITISCAGSSRDVGGFDLVSWYQQHPGKAPKLIIYEVNKRPSGISSRFSASKSGNTASLTISGLQEEDEAHYYCYSYADGVAFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

▶

8. Citations (1)

▶

Unit-cell length a length_a	176.752 Å
Unit-cell length b length_b	176.752 Å
Unit-cell length c length_c	458.039 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	6.801 Å
Low-resolution limit resolution_low	39.631 Å
R factor r_factor	0.3232
R_work r_work	0.3179
R_free r_free	0.4167

fit	/app/data/saxs_computation/ch/6chb/6chb.fit
pddf	/app/data/pr_computation/ch/6chb/6chb.pr.out
profile	/app/data/saxs_computation/ch/6chb/6chb.dat

Crystal structure of a natively-glycosylated BG505 SOSIP.664 HIV-1 Envelope Trimer in complex with the broadly-neutralizing antibodies BG18 and IOMA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope glycoprotein gp41

State in the Current Structure

Other States of the Same Protein in the Database

Envelope glycoprotein gp120

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)