7kts

Negative stain EM structure of the human SAGA coactivator complex (TRRAP, core, splicing module)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ;

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z2U4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–340； UniProt 1–340 Author chain A； PDBConstruct 369–1688； UniProt 369–1688 Author chain A； PDBConstruct 2300–3848； UniProt 2300–3848

TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

OrganismNot specified

UniProt O75529

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF5L_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–589； UniProt 1–589

Isoform 3 of Transcription factor SPT20 homolog

OrganismNot specified

UniProt Q8NEM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SP20H_HUMAN
Isoform	Q8NEM7-3
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–811； UniProt 1–811

;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ;

unclassified Rhodococcus

UniProt O94864

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ST65G_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 52–87； UniProt 52–87 Author chain D； PDBConstruct 119–414； UniProt 119–414

Transcription initiation factor TFIID subunit 9B

OrganismNot specified

UniProt Q9HBM6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF9B_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–251； UniProt 1–251

;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ;

OrganismNot specified

UniProt Q9Y6J9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF6L_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–134； UniProt 1–134 Author chain F； PDBConstruct 375–622； UniProt 375–622

Transcription initiation factor TFIID subunit 12

OrganismNot specified

UniProt Q16514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF12_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–161； UniProt 1–161

Transcription initiation factor TFIID subunit 10

OrganismNot specified

UniProt Q12962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF10_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–218； UniProt 1–218

;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ;

OrganismNot specified

UniProt O75486

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SUPT3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–156； UniProt 1–156 Author chain I； PDBConstruct 187–317； UniProt 187–317

Transcriptional adapter 1

OrganismNot specified

UniProt Q96BN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TADA1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–335； UniProt 1–335

Ataxin-7

OrganismNot specified

UniProt O15265

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATX7_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain N； PDBConstruct 1–892； UniProt 1–892

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain S； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ; × 1 （F2Z2U4） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Isoform 3 of Transcription factor SPT20 homolog × 1 （Q8NEM7） ;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ; × 1 （O94864） Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） ;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ; × 1 （Q9Y6J9） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） ;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ; × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain T； PDBConstruct 1–86； UniProt 1–86

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7kts
Deposition date deposition_date	2020-11-24
Structure title title	Negative stain EM structure of the human SAGA coactivator complex (TRRAP, core, splicing module)
Keywords keywords	splicing, gene regulation, transcription, chromatin; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7kts__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7kts__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7kts__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.99 Å
Rg (electron density)	72.74 Å
Total Rg	72.72 Å
Atom count	100045
Residues	6632
Excluded volume	908870 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7kts__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ;
Molecular weight formula_weight	419168.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	100130

MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVPPPEMVGMITTIAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQELVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTXXXXXXXXXXXXXXXXXXXXXXXXXXXXETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAVEAALPGVPTAPAAPGPAPSPAPVPAPPPPPPPPPPATPVTPAPVPPFEKQGEKDKEDKQTFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQFIPNKQLQPKETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYRRQAWEVIKCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQPRLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLLPGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQERHRKENMAATNWKEPKLLAYCLLNYCKRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQTPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKRRVYERLLYVTCSQNWEAMGNHFWIKQCIELLLAVCEKSTPIGTSCQGAMLPSITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQAFEKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKYSETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEYQLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICHPEEQQLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYFTKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFVKERQLHLGVSAITCYLHACRHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSVGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCYSVAFEKSGAVSDAKITPHTLNFVKKLVSTFGVGLENVSNVSTMFSSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVMNDACLTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSPQMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDILKEVQSNMVPRSMLKEWALHTFPNATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLDNLCRMDPAWHPWL

Entity 2 Entity 2 polymer

Description description	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
Molecular weight formula_weight	66223.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPADGSSSELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH

Entity 3 Entity 3 polymer

Description description	Isoform 3 of Transcription factor SPT20 homolog
Molecular weight formula_weight	88129.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRNVNLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLDPSIAVTCTANRLLYNKQKMNTRPMKRCFKRYSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGNCVDMWKRSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCPVKMSHSSSGSASLSQVSPGKETDQTETVSVQSSVLGKGVKHRPPPIKLPSSSGNSSSGNYFTPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRSGTPKPSTPTPTPSSTPHPPDAQSSTPSTPSATPTPQDSGFTPQPTLLTQFAQQQRSLSQAMPVTTIPLSTMVTSITPGTTATQVMANSAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAAVAILAASNGYGSSSSTNSSATSSSAYRQPVKK

Entity 4 Entity 4 polymer

Description description	;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ;
Molecular weight formula_weight	83013.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNLQRYWGEIPISSSQTNRSSFDLLPREFRLVXXXXXXXXXXXXXXXXXXXMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCKNPNAPFQIRHSDPESDFYRGKGEPVTELSWHSCRQLLYQAVATILAHAGFDCANESVLETLTDVAHEYCLKFTKLLRFAVDREARLGQTPFPDVMEQVFHEVGIGSVLSLQKFWQHRIKDYHSYMLQISKQLSEEYERIVNPEKATEDAKPVKIKEEPVSDITFPVSEELEADLASGDQSLPMGVLGAQSERFPSNLEVEASPQASSAEVNASPLWNLAHVKMEPQESEEGNVSGHGVLGSDVFEEPMSGMSEAGIPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCKKRMRKIGTSGEDLYFQSGGSMAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISGDYKDHDGDYKDHDIDYKDDDDKGS

Source Source

Source organism organism	unclassified Rhodococcus
NCBI taxonomy ID ncbi_taxonomy_id	192944
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Transcription initiation factor TFIID subunit 9B
Molecular weight formula_weight	27654.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM

Entity 6 Entity 6 polymer

Description description	;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ;
Molecular weight formula_weight	62027.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPKGCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLPLPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRFGTGQPAPTAPRPPGDKKEPAAAPDSVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGAPRQQGPGTGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLYLPL

Entity 7 Entity 7 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	17948.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Entity 8 Entity 8 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21731.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Entity 9 Entity 9 polymer

Description description	;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ;
Molecular weight formula_weight	35447.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQXXXXXXXXXXXXCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFTNAYRRNGMAFLAC

Entity 10 Entity 10 polymer

Description description	Transcriptional adapter 1
Molecular weight formula_weight	37432.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Entity 11 Entity 11 polymer

Description description	Ataxin-7
Molecular weight formula_weight	95597.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSERAADDVRGEPRRAAAAAGGAAAAAARQQQQQQQQQQPPPPQPQRQQHPPPPPRRTRPEDGGPGAASTSAAAMATVGERRPLPSPEVMLGQSWNLWVEASKLPGKDGTELDESFKEFGKNREVMGLCREDMPIFGFCPAHDDFYLVVCNDCNQVVKPQAFQSHYERRHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGGVLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPATVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKRLSEREFDPDIHCGVIDLDTKKPCTRSLTCKTHSLTQRRAVQGRRKRFDVLLAEHKNKTREKELIRHPDSQQPPQPLRDPHPAPPRTSQEPHQNPHGVIPSESKPFVASKPKPHTPSLPRPPGCPAQQGGSAPIDPPPVHESPHPPLPATEPASRLSSEEGEGDDKEESVEKLDCHYSGHHPQPASFCTFGSRQIGRGYYVFDSRWNRLRCALNLMVEKHLNAQLWKKIPPVPSTTSPISTRIPHRTNSVPTSQCGVSYLAAATVSTSPVLLSSTCISPNSKSVPAHGTTLNAQPAASGAMDPVCSMQSRQVSSSSSSPSTPSGLSSVPSSPMSRKPQKLKSSKSLRPKESSGNSTNCQNASSSTSGGSGKKRKNSSPLLVHSSSSSSSSSSSSHSMESFRKNCVAHSGPPYPSTVTSSHSIGLNCVTNKANAVNVRHDQSGRGPPTGSPAESIKRMSVMVNSSDSTLSLGPFIHQSNELPVNSHGSFSHSHTPLDKLIGKKRKCSPSSSSINNSSSKPTKVAKVPAVNNVHMKHTGTIPGAQGLMNSSLLHQPKARP

Entity 12 Entity 12 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 13 Entity 13 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	19.09 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	3157

Negative stain EM structure of the human SAGA coactivator complex (TRRAP, core, splicing module)

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein,Transformation/transcription domain-associated protein ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform 3 of Transcription factor SPT20 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA,STAGA complex 65 subunit gamma,STAGA complex 65 subunit gamma, DhaA ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 9B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L,TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog,Transcription initiation protein SPT3 homolog ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcriptional adapter 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer