9rdk

Cryo-EM structure of the human SAGA co-activator complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 9B

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF9B_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–251； UniProt 1–251

Ataxin-7

OrganismNot specified

UniProt O15265

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATX7_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain N； PDBConstruct 1–892； UniProt 1–892

TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

OrganismNot specified

UniProt O75529

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF5L_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain L； PDBConstruct 1–589； UniProt 1–589

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–1217； UniProt 1–1217

Transformation/transcription domain-associated protein

OrganismNot specified

UniProt Q9Y4A5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRRAP_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C； PDBConstruct 1–3859； UniProt 1–3859

STAGA complex 65 subunit gamma

OrganismNot specified

UniProt O94864

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ST65G_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D； PDBConstruct 1–414； UniProt 1–414

Transcription initiation factor TFIID subunit 12

OrganismNot specified

UniProt Q16514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF12_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–161； UniProt 1–161

Transcription initiation factor TFIID subunit 10

OrganismNot specified

UniProt Q12962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF10_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–218； UniProt 1–218

Transcription initiation protein SPT3 homolog

OrganismNot specified

UniProt O75486

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SUPT3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–317； UniProt 1–317

Transcriptional adapter 1

OrganismNot specified

UniProt Q96BN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TADA1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–335； UniProt 1–335

TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L

OrganismNot specified

UniProt Q9Y6J9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） Transcription factor SPT20 homolog × 1 （Q8NEM7） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF6L_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–622； UniProt 1–622

Transcription factor SPT20 homolog

OrganismNot specified

UniProt Q8NEM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Splicing factor 3B subunit 5 × 1 （Q9BWJ5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SP20H_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–779； UniProt 1–779

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Transcription initiation factor TFIID subunit 9B × 1 （Q9HBM6） Ataxin-7 × 1 （O15265） TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L × 1 （O75529） Splicing factor 3B subunit 3 × 1 （Q15393） Transformation/transcription domain-associated protein × 1 （Q9Y4A5） STAGA complex 65 subunit gamma × 1 （O94864） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation protein SPT3 homolog × 1 （O75486） Transcriptional adapter 1 × 1 （Q96BN2） TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L × 1 （Q9Y6J9） Transcription factor SPT20 homolog × 1 （Q8NEM7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain B； PDBConstruct 1–86； UniProt 1–86

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rdk
Deposition date deposition_date	2025-06-03
Structure title title	Cryo-EM structure of the human SAGA co-activator complex
Keywords keywords	Transcription co-activator, Lysine acetyltransferase, complex, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rdk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rdk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rdk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	75.52 Å
Rg (electron density)	76.10 Å
Total Rg	76.13 Å
Atom count	54084
Residues	6751
Excluded volume	969300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rdk__assembly_1__model_1`	13-meric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Transcription initiation factor TFIID subunit 9B
Molecular weight formula_weight	27654.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	54084

MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM

Entity 2 Entity 2 polymer

Description description	Ataxin-7
Molecular weight formula_weight	95597.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSERAADDVRGEPRRAAAAAGGAAAAAARQQQQQQQQQQPPPPQPQRQQHPPPPPRRTRPEDGGPGAASTSAAAMATVGERRPLPSPEVMLGQSWNLWVEASKLPGKDGTELDESFKEFGKNREVMGLCREDMPIFGFCPAHDDFYLVVCNDCNQVVKPQAFQSHYERRHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGGVLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPATVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKRLSEREFDPDIHCGVIDLDTKKPCTRSLTCKTHSLTQRRAVQGRRKRFDVLLAEHKNKTREKELIRHPDSQQPPQPLRDPHPAPPRTSQEPHQNPHGVIPSESKPFVASKPKPHTPSLPRPPGCPAQQGGSAPIDPPPVHESPHPPLPATEPASRLSSEEGEGDDKEESVEKLDCHYSGHHPQPASFCTFGSRQIGRGYYVFDSRWNRLRCALNLMVEKHLNAQLWKKIPPVPSTTSPISTRIPHRTNSVPTSQCGVSYLAAATVSTSPVLLSSTCISPNSKSVPAHGTTLNAQPAASGAMDPVCSMQSRQVSSSSSSPSTPSGLSSVPSSPMSRKPQKLKSSKSLRPKESSGNSTNCQNASSSTSGGSGKKRKNSSPLLVHSSSSSSSSSSSSHSMESFRKNCVAHSGPPYPSTVTSSHSIGLNCVTNKANAVNVRHDQSGRGPPTGSPAESIKRMSVMVNSSDSTLSLGPFIHQSNELPVNSHGSFSHSHTPLDKLIGKKRKCSPSSSSINNSSSKPTKVAKVPAVNNVHMKHTGTIPGAQGLMNSSLLHQPKARP

Entity 3 Entity 3 polymer

Description description	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
Molecular weight formula_weight	66223.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPADGSSSELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH

Entity 4 Entity 4 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 5 Entity 5 polymer

Description description	Transformation/transcription domain-associated protein
Molecular weight formula_weight	438139.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVPPPEMVGMITTIAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQELVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAVEAALPGVPTAPAAPGPAPSPAPVPAPPPPPPPPPPATPVTPAPVPPFEKQGEKDKEDKQTFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQFIPNKQLQPKETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYRRQAWEVIKCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQPRLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESISECGRCPLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLLPGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQERHRKENMAATNWKEPKLLAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEKGEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHDNNKNRNSKLRRLMTFAWPCLLSKACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHHLVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLMTVEQPNQVNYGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKVLRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYEKATNANPSQLFGTLMILKSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQTPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKRRVYERLLYVTCSQNWEAMGNHFWIKQCIELLLAVCEKSTPIGTSCQGAMLPSITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQAFEKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKYSETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEYQLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICHPEEQQLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQGKPTWSGMHSSSIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYFTKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFVKERQLHLGVSAITCYLHACRHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCYSVAFEKSGAVSDAKITPHTLNFVKKLVSTFGVGLENVSNVSTMFSSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVMNDACLTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSPQMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDILKEVQSNMVPRSMLKEWALHTFPNATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLDNLCRMDPAWHPWL

Entity 6 Entity 6 polymer

Description description	STAGA complex 65 subunit gamma
Molecular weight formula_weight	46243.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNLQRYWGEIPISSSQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSDPESDFYRGKGEPVTELSWHSCRQLLYQAVATILAHAGFDCANESVLETLTDVAHEYCLKFTKLLRFAVDREARLGQTPFPDVMEQVFHEVGIGSVLSLQKFWQHRIKDYHSYMLQISKQLSEEYERIVNPEKATEDAKPVKIKEEPVSDITFPVSEELEADLASGDQSLPMGVLGAQSERFPSNLEVEASPQASSAEVNASPLWNLAHVKMEPQESEEGNVSGHGVLGSDVFEEPMSGMSEAGIPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCKKRMRKI

Entity 7 Entity 7 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	17948.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Entity 8 Entity 8 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21731.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Entity 9 Entity 9 polymer

Description description	Transcription initiation protein SPT3 homolog
Molecular weight formula_weight	35840.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFTNAYRRNGMAFLAC

Entity 10 Entity 10 polymer

Description description	Transcriptional adapter 1
Molecular weight formula_weight	37432.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Entity 11 Entity 11 polymer

Description description	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
Molecular weight formula_weight	67903.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPKGCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYHQVTRAVLGDDPQLMKVALQDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPHLCLGPYVRCLVGSVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADPVRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLPLPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRFGTGQPAPTAPRPPGDKKEPAAAPDSVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGAPRQQGPGTGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLYLPL

Entity 12 Entity 12 polymer

Description description	Transcription factor SPT20 homolog
Molecular weight formula_weight	85884.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRNVNLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLDPSIAVTCTANRLLYNKQKMNTRPMKRCFKRYSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGNCVDMWKRSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCPVKMSHSSSGSASLSQVSPGKETDQTETVSVQSSVLGKGVKHRPPPIKLPSSSGNSSSGNYFTPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF

Entity 13 Entity 13 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.41 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	272167

Cryo-EM structure of the human SAGA co-activator complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 9B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ataxin-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transformation/transcription domain-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

STAGA complex 65 subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation protein SPT3 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcriptional adapter 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer