8f29

Yeast ATP synthase in conformation-1 at pH 6

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 5, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPO_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Y； PDBConstruct 1–187； UniProt 24–210

ATP synthase subunit gamma, mitochondrial

OrganismNot specified

UniProt P38077

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–261； UniProt 38–307

ATP synthase subunit delta, mitochondrial

OrganismNot specified

UniProt Q12165

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPD_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–132； UniProt 29–160

ATP synthase subunit epsilon, mitochondrial

OrganismNot specified

UniProt P21306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5E_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–59； UniProt 2–60

ATP synthase subunit 4, mitochondrial

OrganismNot specified

UniProt P05626

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPF_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Z； PDBConstruct 1–155； UniProt 88–242

ATP synthase subunit d, mitochondrial

OrganismNot specified

UniProt P30902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP7_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 7； PDBConstruct 1–171； UniProt 4–174

ATP synthase subunit H, mitochondrial

OrganismNot specified

UniProt Q12349

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP14_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6； PDBConstruct 1–89； UniProt 36–124

ATP synthase subunit f, mitochondrial

OrganismNot specified

UniProt Q06405

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPK_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain U； PDBConstruct 1–85； UniProt 7–91

ATP synthase subunit 9, mitochondrial

OrganismNot specified

UniProt P61829

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–75； UniProt 1–75 Author chain L； PDBConstruct 1–75； UniProt 1–75 Author chain M； PDBConstruct 1–75； UniProt 1–75 Author chain N； PDBConstruct 1–75； UniProt 1–75 Author chain O； PDBConstruct 1–75； UniProt 1–75 Author chain P； PDBConstruct 1–75； UniProt 1–75 Author chain Q； PDBConstruct 1–75； UniProt 1–75 Author chain R； PDBConstruct 1–75； UniProt 1–75 Author chain S； PDBConstruct 1–75； UniProt 1–75 Author chain T； PDBConstruct 1–75； UniProt 1–75

ATP synthase protein 8

OrganismNot specified

UniProt P00856

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP8_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 8； PDBConstruct 1–41； UniProt 7–47

ATP synthase subunit a

OrganismNot specified

UniProt P00854

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP6_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain X； PDBConstruct 1–224； UniProt 36–259

ATP synthase subunit J, mitochondrial

OrganismNot specified

UniProt P81450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP18_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–37； UniProt 1–37

ATP synthase subunit alpha, mitochondrial

OrganismNot specified

UniProt P07251

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit beta, mitochondrial × 3 （P00830） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPA_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain A； PDBConstruct 1–507； UniProt 39–545 Author chain B； PDBConstruct 1–507； UniProt 39–545 Author chain C； PDBConstruct 1–507； UniProt 39–545

ATP synthase subunit beta, mitochondrial

OrganismNot specified

UniProt P00830

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ADENOSINE-5'-DIPHOSPHATE × 5 MAGNESIUM ION × 5 PHOSPHATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPB_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain D； PDBConstruct 1–473； UniProt 39–511 Author chain E； PDBConstruct 1–473； UniProt 39–511 Author chain F； PDBConstruct 1–473； UniProt 39–511

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8f29
Deposition date deposition_date	2022-11-07
Structure title title	Yeast ATP synthase in conformation-1 at pH 6
Keywords keywords	F-type ATP synthase, yeast, mitochondrial, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8f29__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8f29__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8f29__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	62.16 Å
Rg (electron density)	63.93 Å
Total Rg	64.08 Å
Atom count	38906
Residues	5116
Excluded volume	701100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8f29__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit 5, mitochondrial
Molecular weight formula_weight	20199.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y
Atom count atom_count	38906

PPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLLVELGDKTVDLSISTKIQKLIKVLED

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit gamma, mitochondrial
Molecular weight formula_weight	28984.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

EVEMRLKSINAIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGA

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit delta, mitochondrial
Molecular weight formula_weight	14080.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

SSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK

Entity 4 Entity 4 polymer

Description description	ATP synthase subunit epsilon, mitochondrial
Molecular weight formula_weight	6388.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit 4, mitochondrial
Molecular weight formula_weight	17562.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

NDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVVSRVQSELGNPKFQEKVLQQSISEIEQLLSK

Entity 6 Entity 6 polymer

Description description	ATP synthase subunit d, mitochondrial
Molecular weight formula_weight	19509.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

AKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit H, mitochondrial
Molecular weight formula_weight	10090.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

QDLYLRELKDTKLAPSTLQDAEGNVKPWNPPQKPNLPELELQGPEALKAYTEQNVETAHVAKESEEGESEPIEEDWLVLDDAEETKESH

Entity 8 Entity 8 polymer

Description description	ATP synthase subunit f, mitochondrial
Molecular weight formula_weight	9383.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

VSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFH

Entity 9 Entity 9 polymer

Description description	ATP synthase subunit 9, mitochondrial
Molecular weight formula_weight	7663.2 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,K,L,M,N,O,P,Q,R

MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFG

Entity 10 Entity 10 polymer

Description description	ATP synthase protein 8
Molecular weight formula_weight	5046.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

FYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISK

Entity 11 Entity 11 polymer

Description description	ATP synthase subunit a
Molecular weight formula_weight	25073.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

LTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH

Entity 12 Entity 12 polymer

Description description	ATP synthase subunit J, mitochondrial
Molecular weight formula_weight	4145.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNT

Entity 13 Entity 13 polymer

Description description	ATP synthase subunit alpha, mitochondrial
Molecular weight formula_weight	54748.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C

KAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF

Entity 14 Entity 14 polymer

Description description	ATP synthase subunit beta, mitochondrial
Molecular weight formula_weight	50752.6 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

STPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN

Entity 15 Entity 15 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 16 Entity 16 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 17 Entity 17 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	146826

Yeast ATP synthase in conformation-1 at pH 6

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 5, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit gamma, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit delta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit epsilon, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit d, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit H, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit f, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase protein 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer