8fed

Structure of Mce1-LucB complex from Mycobacterium smegmatis (Map1)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virulence factor Mce family protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QNR2_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–409； UniProt 1–409

Virulence factor Mce family protein

OrganismNot specified

UniProt A0QNR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QNR3_MYCS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–343； UniProt 1–343

MCE-family protein MCE1c

OrganismNot specified

UniProt I7G2J2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7G2J2_MYCS2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–524； UniProt 1–524

Virulence factor mce family protein

OrganismNot specified

UniProt A0QNR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QNR5_MYCS2
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–547； UniProt 1–547

Virulence factor Mce family protein

OrganismNot specified

UniProt A0QNR6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QNR6_MYCS2
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–390； UniProt 1–390

Mce-family protein mce1f

OrganismNot specified

UniProt A0QNR7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QNR7_MYCS2
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–518； UniProt 1–518

ABC transporter, ATP-binding protein,Green fluorescent protein chimera

OrganismNot specified

UniProt A0QS64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QS64_MYCS2
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–360； UniProt 1–360 Author chain H； PDBConstruct 1–360； UniProt 1–360

ABC transporter, ATP-binding protein,Green fluorescent protein chimera

OrganismNot specified

UniProt P42212

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFP_AEQVI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 424–629； UniProt 33–238 Author chain H； PDBConstruct 424–629； UniProt 33–238

Conserved hypothetical integral membrane protein Yrbe1a

OrganismNot specified

UniProt I7F4Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） ABC-transporter integral membrane protein × 1 （A0QNR1） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7F4Q4_MYCS2
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–266； UniProt 1–266

ABC-transporter integral membrane protein

OrganismNot specified

UniProt A0QNR1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） Transmembrane protein × 1 （A0QWR2） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QNR1_MYCS2
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–289； UniProt 1–289

Transmembrane protein

OrganismNot specified

UniProt A0QWR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 11	Virulence factor Mce family protein × 1 （A0QNR2） Virulence factor Mce family protein × 1 （A0QNR3） MCE-family protein MCE1c × 1 （I7G2J2） Virulence factor mce family protein × 1 （A0QNR5） Virulence factor Mce family protein × 1 （A0QNR6） Mce-family protein mce1f × 1 （A0QNR7） ABC transporter, ATP-binding protein,Green fluorescent protein chimera × 2 （A0QS64,P42212） Conserved hypothetical integral membrane protein Yrbe1a × 1 （I7F4Q4） ABC-transporter integral membrane protein × 1 （A0QNR1） UNKNOWN LIGAND × 31	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QWR2_MYCS2
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–191； UniProt 1–191

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fed
Deposition date deposition_date	2022-12-06
Structure title title	Structure of Mce1-LucB complex from Mycobacterium smegmatis (Map1)
Keywords keywords	Membrane protein complex, ABC transporter, Virulence factor, Lipid transport, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8fed__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8fed__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8fed__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	90.34 Å
Rg (electron density)	93.12 Å
Total Rg	92.93 Å
Atom count	26565
Residues	3427
Excluded volume	475690 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8fed__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Virulence factor Mce family protein
Molecular weight formula_weight	43944.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	26565

MTEPPAPTAPLNKPKTPPYKLAGLILGLVGVLVLALTWMQFRGQFEDKVQLTVLSGRAGLSMDPGSKVTFNGVPIGRLASIDVVEVDDNPEARLTLDVDPKYLDLIPENANVELRATTVFGNKYISFLSPKNPSAERLSASTPIRAQGVTTEFNTLFETITAISEQVDPIKLNETLTAAAQALDGLGDKFGRSIVDGNAILADVNPRMPQIRRDITGLANLGEVYADASPDLFDGLDNAVTTARTLNEQRGNLDQALVAAVGFGNTGGDIFERGGPYLVRGAQDLLPTSALLDEYSPALFCTIRNYHDAAPKLAGALGGNGYSLLTNSLVVGVGNPYVYPDNLPRVNAKGGPEGRPGCWQPITRDLWPFPYLVMDTGASIAPYNHFELGQPMFAEYVWGRQVGENTINP

Entity 2 Entity 2 polymer

Description description	Virulence factor Mce family protein
Molecular weight formula_weight	37467.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSIKGTLFKLGIFSLVLLTFTALIFVVFGQIRFNRTTEYSAIFKNVSGLRDGQFVRAAGVEVGKVKSVDLINGGEQAEVKFTVERSLPLFQETTAAIRYQDLIGNRYLELKRGDSDQILPPGSTIPVERTEPALDLDALVGGFRPLFRSLEPEKVNTIATSLITIFQGQGGTINDILDQTAQLTASLADRDQAIGEVIKNLNTVLDTTVRHQKQFDETLVNFETLITGLKNRADPIATSVADISDAAGSLADLLSDNRPLLKDTIGYLDVIQAPLVEQKQEVSDILVQMPQALKIIGRAGGIYGDFFNFYACDLTLKLNGLQPGGPVRTVRITTQPSGRCTPK

Entity 3 Entity 3 polymer

Description description	MCE-family protein MCE1c
Molecular weight formula_weight	54737.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MRTLQGSDRFRKGLMGVIVVALIIGVGSTLTSVPMLFAVPTYYGQFADTGGLNIGDKVRIAGMDVGNVKSMEIDGDKVVIGYTLGGRTIGTESRAAIRTDTILGRKNIEIEPRGSETLKPRGVLPVGQTSAPYQIYDAFLDVTRNAAGWDTQAVRQSLNVLSETVDQTSPHLSAALDGVARFSETIGKRDEDVKKLLASANKVATVLGDRSTQVNQLLVNAQTLLAAVNERGRSVSLLLERVSSVSRQVEGFVDENPNLNHVLEQLRTVSDVLNERKQDLADILTVAGKFITSLAEALASGPYFKVMLVNLIPPTILQPFVDAAFKKRGIDPEEFWRNAGLPAFRFPDPNGERHENGAPPAAPTPLEGTPEHPGPAVPPGSPCSYTPPADGIPSPGNPLPCAHLSQGPYGPVPGGYPPPNVATSAPNPDGIAHSPGVPSAAIPGQMPPEQPGAPVEIAPGPPGARTVPVSPIPGAPDFTPGIAPPPPAITGPPPPPGPGPQLAPVGEAPLPGNPPFLPPGSQSR

Entity 4 Entity 4 polymer

Description description	Virulence factor mce family protein
Molecular weight formula_weight	58054.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSTIFNIRNIQLPRLSRAAVIIGALVVAAALVAGYFGMNAYRKLTNTTVTAYFPEVLALYPGDKVLIMGVRVGSIDSIETAGDKMKVVFHFNNKYKVPENATASILNPSLVASRVIQLSPPYTGGPTLRDGAVLDVDRTQVPIEYDEVRNQVTRLLADLGPTPEQPKGPFGDIIESFADGFAGKGEQLNRTLRGLSDALTALNEGRGDFFAVVKSLALFVNALHRSDQQFVALNNDLAQFTNSFTNTDQELANALQDLNRVLKTTREFLDRNGGVLTHDIDNLEQVTTAILQPEPRDGLETGLHAYPNLAANVLNINSPNQGGIIGLPVLPGVTNFSNPLQFVCSSIQAGSRLGYQESAELCAQYLAPIMDAIKFNYLPFGMNLASTAMTLPKQIAYSEKRLQPPPGYKDTTVPGIWSRDTLFSHGNHEPGWIVAPGMQGVQVQPATANMLTPESLAELLGGPDIVPPPAPPAFGTTRGGNLPGPPNAFDENNPLPPPWYPQPGPPPAPAPGVIPGDPLSAVAPAAPAAPAAPAPAGPPLPAEAGAG

Entity 5 Entity 5 polymer

Description description	Virulence factor Mce family protein
Molecular weight formula_weight	42566.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MRLLKGFPKMRNWTRVGRRTAVLAAVALVLTSCGQWRGIANVPLPGGPGTESGSMTLYVQMPETLALNANSRVRVRDVFVGRVRKIELINWVPTLTVDVEPGIKLPKNTLAKIGQTSLLGSQHVELNPPEDPSSELLRDGDTIPLAQSSAYPTIERTLAGISGILTGGGIPNIEVIQTEVFNILNGRADQIREFLNQLDTFTDELNQQREEITRAIDSTNRLLNIVSQRNDTLDRVLTEFPPLIQHFAETRDLFADAVTALGRLSAAADETLSGSNANLHTNLQNLQRPLKQLGRAAPYLVGALKLILTVPFNIDNIPKAIRGDYINVSLKLDLTLSSVDNAFLSGTGVSGMLRALEQAWGRDPATMIPDVRFTPNPHDAPGGPLVERGE

Entity 6 Entity 6 polymer

Description description	Mce-family protein mce1f
Molecular weight formula_weight	54342.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MLLTRFIKMQLVIFLTLTLVALVVLALFYLRLPTWAGLGMYKLNADLPNSGGLYATANVTYRGTTIGKVTSVEPSESGARVEMNIYDRYKIPADATANVHSVSAVGEQFIDLTSDSGGGAYFQPGDTITKATVPAEVGPALDAAEKGLAVLPKEKIGTLLDEAATAFGGLGPSLQRLVDSTQAIAGDFRANIDPVNDIIENSGPIIDSQVNSGDAIQRWAANLNTLAAQSAQNDEALRSGLQQAAPTADQLNAVFSDVRESLPQTLANLEIVIDMLKRYNKNVEQVLVALPQGAAVAQTGTIFAPEGLLHFGLGINAPPPCLTGFLPASQWRSPADTRTEPLPSGLYCKIPKDAPNAVRGARNYPCADVPGKRAATPRECRSDEPYQPLGTNPWYGDPDQIRNCPAPGARCDQPVDPGRVIPAPSINNGLNPLPASQLPPPEVSSGPSSDPLTAPRGGTVTCSGQQPNPCIYTPAAGATATYNPASGEVVGPGGVKYSVTNSNTPGDDGWKEMLAPAS

Entity 7 Entity 7 polymer

Description description	ABC transporter, ATP-binding protein,Green fluorescent protein chimera
Molecular weight formula_weight	71624.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

MGVQIDVTGLSKSFGSSKIWEDVTMSIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIVIDGTDILQCSAKELYEIRTLFGVLFQDGALFGSMNIYDNTAFPLREHTKKSESEIRKIVMEKLDLVGMPNDGHKFPGEISGGMRKRAGLARALVLDPEIILCDEPDSGLDPVRTAYLSQLLIDINAQIDATVLIVTHNINIARTVPDNMGMLFRKQLVMFGPREVLLTSEEPVVKQFLNGRRIGPIGMSEEKDEATAAAEQALVDAGQHDGGVEEIEGVPPQLQATPGMPERKAVARRKARVREILHTLPPAAQAAILEELDRDQPQLSAPTTQTAATAPVENYDDSPTGVIEVPKQAGLSGQPPRSPSSGSSSNSLEVLFQGPTAAAAVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGENLYFQDYKDDDDKHHHHHH

Entity 8 Entity 8 polymer

Description description	Conserved hypothetical integral membrane protein Yrbe1a
Molecular weight formula_weight	27674.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTASTDGFVDYLRGQLEKPLATVGGFFKMSVMTGKALFTRPFQWKEFVLQSWFLIRVAFLPTLAVSIPLTVLIIFTLNILLAEFGAADVSGAGAALGAVTQLGPLVTVLVVAGAGSTAICADLGARTVREEIDALEVLGIDPIERLVVPRVVASTFVAFMLNGAVITIGLVGGFFFGVYIQNVSAGAYVSTLTLLTGFPEVLISVVKATLFGMIAGLVGCYRGLTVAGGSKGVGTAVNETLVLCVVALFAVNVVLTTIGVRFGTGR

Entity 9 Entity 9 polymer

Description description	ABC-transporter integral membrane protein
Molecular weight formula_weight	30809.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSTVQVLRSRFPRAFSRSSEIAATPARFLDSMGHVAWFVVQAIVHVPHAFRHYRRESLRLVAEIGMGTGAMAVIGGTVAIIGFVTLSAGSLIAIQGFASLGNIGVEAFTGFFAALANIRVVAPVVTGQALAATVGAGATAELGAMRISEEVDALEVMGIKSISYLVSTRIMAGAIVIIPLYAMAILLSFMSAQLVTTIFYSQSVGTYEHYFHTFLRVDDVMWSFLEVIIMSVIVMLNHCYFGYFASGGAVGVGEAVGRSMRTSLIAIVLVVLLASLALYGTDPNFNLTV

Entity 10 Entity 10 polymer

Description description	Transmembrane protein
Molecular weight formula_weight	20477.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSKWLLRGVVFATAMVIVRLLQGALVNASPGNAIWFSTGLLVLYAIGVAVWGVLDGRGDARSNPDPDRRADLAMTWLLAGLAAGILSGAVSWFIGLFYKSIYTESLLNEITTFAAFTALLTFLVAVAGVTIGRWTIDRKAPPVTRTRHGLAADDDRADTDVFAAVSANGAQEHTDTTQTTPLENPDQPRQS

Entity 11 Entity 11 non-polymer

Description description	UNKNOWN LIGAND
Source method src_method	syn
Copy count entity_count	31

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	8fedG01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	8fedH01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.76 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	144822

Structure of Mce1-LucB complex from Mycobacterium smegmatis (Map1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virulence factor Mce family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Virulence factor Mce family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MCE-family protein MCE1c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Virulence factor mce family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Virulence factor Mce family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mce-family protein mce1f

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ABC transporter, ATP-binding protein,Green fluorescent protein chimera

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ABC transporter, ATP-binding protein,Green fluorescent protein chimera

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Conserved hypothetical integral membrane protein Yrbe1a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ABC-transporter integral membrane protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer