8tb9

PRC2-J119-450 monomer bound to H1-nucleosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H1.0

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H10_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–197； UniProt 1–194

Protein Jumonji

Homo sapiens

UniProt Q92833

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	JARD2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–334； UniProt 119–450

Polycomb protein SUZ12

Homo sapiens

UniProt Q15022

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SUZ12_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 2–619； UniProt 68–685

Histone-lysine N-methyltransferase EZH2

Homo sapiens

UniProt Q15910

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EZH2_HUMAN
Isoform	Q15910-2
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 4–753； UniProt 2–751

Polycomb protein EED

Homo sapiens

UniProt O75530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EED_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–441； UniProt 1–441

Histone H3.2

Xenopus laevis

UniProt P84233

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H32_XENLA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–136； UniProt 1–136 Author chain W； PDBConstruct 1–136； UniProt 1–136

Histone H4

Xenopus laevis

UniProt P62799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_XENLA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–103； UniProt 1–103 Author chain X； PDBConstruct 1–103； UniProt 1–103

Histone-binding protein RBBP4

Homo sapiens

UniProt Q09028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBBP4_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain O； PDBConstruct 1–425； UniProt 1–425

Histone H2A type 1

Xenopus laevis

UniProt P06897

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1_XENLA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain R； PDBConstruct 4–133； UniProt 1–130 Author chain U； PDBConstruct 4–133； UniProt 1–130

Histone H2B 1.1

Xenopus laevis

UniProt P02281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） DNA (226-MER) × 1 Zinc finger protein AEBP2 × 1 （Q6ZN18） S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B11_XENLA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain S； PDBConstruct 2–123； UniProt 5–126 Author chain V； PDBConstruct 2–123； UniProt 5–126

Zinc finger protein AEBP2

Homo sapiens

UniProt Q6ZN18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Histone H1.0 × 1 （P07305） Protein Jumonji × 1 （Q92833） Polycomb protein SUZ12 × 1 （Q15022） Histone-lysine N-methyltransferase EZH2 × 1 （Q15910） Polycomb protein EED × 1 （O75530） DNA (226-MER) × 1 Histone H3.2 × 2 （P84233） Histone H4 × 2 （P62799） Histone-binding protein RBBP4 × 1 （Q09028） Histone H2A type 1 × 2 （P06897） Histone H2B 1.1 × 2 （P02281） DNA (226-MER) × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AEBP2_HUMAN
Isoform	Q6ZN18-3
PDB entities	13
Chains and sequence ranges	Author chain Y； PDBConstruct 4–303； UniProt 2–301

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8tb9
Deposition date deposition_date	2023-06-28
Structure title title	PRC2-J119-450 monomer bound to H1-nucleosome
Keywords keywords	Histone methyl transferase, gene repression, epigenetics, chromatin, GENE REGULATION; GENE REGULATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8tb9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8tb9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8tb9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.68 Å
Rg (electron density)	67.71 Å
Total Rg	67.77 Å
Atom count	30224
Residues	3175
Excluded volume	511220 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8tb9__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	Histone H1.0
Molecular weight formula_weight	21209.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	30224

GSHMTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein Jumonji
Molecular weight formula_weight	36251.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MVQSQPNSPSTTPVKIVEPLLPPPATQISDLSKRKPKTEDFLTFLCLRGSPALPNSMVYFGSSQDEEEVEEEDDETEDVKTATNNASSSCQSTPRKGKTHKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQASANHPAAAPSTGSSAKGLAATHHHPPLHRSAQDLRKQVSKVNGVTRMSSLGAGVTSAKKMREVRPSPSKTVKYTATVTKGAVTYTKAKRELVKDTKPNHHKPSSAVNHTISGKTESSNAKTRKQVLSLGGASKSTGPAVNGLKVSGRLNPKSCTKEVGGRQLREGLQLREGLRNSKRRLEEAHQA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Polycomb protein SUZ12
Molecular weight formula_weight	72266.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Histone-lysine N-methyltransferase EZH2
Molecular weight formula_weight	86175.0 kDa
EC 编号 ec_number	2.1.1.356
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

SNAGQTGKKSEKGPVACRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Polycomb protein EED
Molecular weight formula_weight	50267.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	DNA (226-MER)
Molecular weight formula_weight	66539.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	H

ATCGGGAGCTCCGACCGAATGACATGCATGCATACAGGATGTATATACCTGACACGTGCCTGGAGACTAGGGAGTAACCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGCCTACGACCAATGGAGCGGCCTCGGCACCGGGATCCCCCAGCCGCCGGCAGCGCAGCGCCTGACGGGCACACAGTC

Entity 7 Entity 7 polymer

Description description	Histone H3.2
Molecular weight formula_weight	15435.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,W

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Histone H4
Molecular weight formula_weight	11625.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,X

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGSSG

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	Histone-binding protein RBBP4
Molecular weight formula_weight	47709.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Histone H2A type 1
Molecular weight formula_weight	14355.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,U

SNAMSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKCTESSKSAKSK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	Histone H2B 1.1
Molecular weight formula_weight	13655.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,V

MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	DNA (226-MER)
Molecular weight formula_weight	65905.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

GACTGTGTGCCCGTCAGACGCTGCGCCGCCGGCGGCCGGAGAATCCCGGTGCCGAGGCCGCCCTATTGGTCGTAGACAGCCCCAGCACCGCCTAAACGCACGTACGCGCCGTCCCCCGCGTTTTAACCGCCAAGGGGATTACCCCCCAGTCCCCAGGCACGTGCCAGATATATACATCCCGTACGCACGCACATCATTCGATCGGAGCTCCCGAT

Entity 13 Entity 13 polymer

Description description	Zinc finger protein AEBP2
Molecular weight formula_weight	34183.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

SNAYTRRYSSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSKQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 non-polymer

Description description	S-ADENOSYL-L-HOMOCYSTEINE
Molecular weight formula_weight	384.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	55918

PRC2-J119-450 monomer bound to H1-nucleosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H1.0

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein Jumonji

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Polycomb protein SUZ12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone-lysine N-methyltransferase EZH2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Polycomb protein EED

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H3.2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone-binding protein RBBP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A type 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B 1.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer