9rpd

D. melanogaster Augmin TII N-clamp (GST-fusion) bound to a microtubule, well-defined subset of particles

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Augmin complex subunit dgt4

Drosophila melanogaster

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 9	Augmin complex subunit dgt6 × 1 （Q9VAP2） Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme × 1 （P08515,P42212,Q9W0G6） Tubulin beta chain × 2 （P02554） Tubulin alpha-1A chain × 4 （P02550）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DGT4_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain I； PDBConstruct 1–108； UniProt 1–108

Augmin complex subunit dgt6

Drosophila melanogaster

UniProt Q9VAP2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 9	Augmin complex subunit dgt4 × 1 （Q9W4M8） Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme × 1 （P08515,P42212,Q9W0G6） Tubulin beta chain × 2 （P02554） Tubulin alpha-1A chain × 4 （P02550）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DGT6_DROME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–280； UniProt 1–280

Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme

Schistosoma japonicum

UniProt P08515

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 9	Augmin complex subunit dgt4 × 1 （Q9W4M8） Augmin complex subunit dgt6 × 1 （Q9VAP2） Tubulin beta chain × 2 （P02554） Tubulin alpha-1A chain × 4 （P02550）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GST26_SCHJA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 445–662； UniProt 1–218

Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme

Schistosoma japonicum

UniProt P42212

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 9	Augmin complex subunit dgt4 × 1 （Q9W4M8） Augmin complex subunit dgt6 × 1 （Q9VAP2） Tubulin beta chain × 2 （P02554） Tubulin alpha-1A chain × 4 （P02550）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFP_AEQVI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 204–440； UniProt 2–238

Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme

Schistosoma japonicum

UniProt Q9W0G6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 9	Augmin complex subunit dgt4 × 1 （Q9W4M8） Augmin complex subunit dgt6 × 1 （Q9VAP2） Tubulin beta chain × 2 （P02554） Tubulin alpha-1A chain × 4 （P02550）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MSD5_DROME
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 1–179； UniProt 1–179

Tubulin beta chain

OrganismNot specified

UniProt P02554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 9	Augmin complex subunit dgt4 × 1 （Q9W4M8） Augmin complex subunit dgt6 × 1 （Q9VAP2） Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme × 1 （P08515,P42212,Q9W0G6） Tubulin alpha-1A chain × 4 （P02550）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–445； UniProt 1–445 Author chain D； PDBConstruct 1–445； UniProt 1–445

Tubulin alpha-1A chain

OrganismNot specified

UniProt P02550

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 9	Augmin complex subunit dgt4 × 1 （Q9W4M8） Augmin complex subunit dgt6 × 1 （Q9VAP2） Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme × 1 （P08515,P42212,Q9W0G6） Tubulin beta chain × 2 （P02554）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–451； UniProt 1–451 Author chain C； PDBConstruct 1–451； UniProt 1–451 Author chain E； PDBConstruct 1–451； UniProt 1–451 Author chain G； PDBConstruct 1–451； UniProt 1–451

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rpd
Deposition date deposition_date	2025-06-24
Structure title title	D. melanogaster Augmin TII N-clamp (GST-fusion) bound to a microtubule, well-defined subset of particles
Keywords keywords	;augmin, N-clamp, TII, microtubule, branching, nucleation, HAUS, HAUS augmin-like complex subunit, HAUS6, HAUS7, HAUS2, HAUS8, Dgt6, Msd5, Dgt4, Msd1, Drosophila melanogaster, complex, CH domain, calponin homology domain, CELL CYCLE, MAP, cell division ;; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rpd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rpd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rpd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.58 Å
Rg (electron density)	48.25 Å
Total Rg	48.41 Å
Atom count	41510
Residues	2772
Excluded volume	386110 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rpd__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Augmin complex subunit dgt4
Molecular weight formula_weight	12246.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I
Atom count atom_count	41510

METPPTPTTTTPPSLTTEGTMDDIQYLLHLEAMRRFQEDSRNVKRQVEEQVRIWLDAKCEYQRDFGRLARLLKCGALQAAVDAHRVSDVNQVDQAAKDIASLRSKLGS

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Augmin complex subunit dgt6
Molecular weight formula_weight	32382.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MDRTIIAPWKAEEKEQSEKLHRKLQGLALVHPLPDELRKLIAWDMFLKPNQVAFVHVMHYLFRLLDPAEFKRRFFWPITDKKSEANFRSSTVEYLKHLNEKHQLHWANIKSYLVVMPGGMRFINFLLEFVGFVIQELIKQREKSLGLEAGTPNVSAKVMARQNAVMKEYASSYVVNLEENTALLRDKTQKIRRLMADLSADMGVPEEQLADDGFLDEFEATAALGVERVITQPTERKFDLEASLCGLKEAIDLFQVKQAENNQSKEAVEKALRGMRVLFD

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme
Molecular weight formula_weight	76561.1 kDa
EC 编号 ec_number	2.5.1.18
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

METNVDFSSISSKLYRKYAQHVRNLKDVCVSKTVMKPGAFFDSLQQMMEEEAAATTPPRDLSSVADYAELFKTLEEYPANLQKMPKKRELQRTNSTLLRGADESVAMGINTSNVSLSLTRLEEQRSAVDVYNDFKGFQRKLAKIYDEAAALDTTESIYKQKLTQLHGFAQQLEKLMPTGLSGENLYFQGGSAGSAAGSGEFMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKLEVLMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGPHHHHHHHH

Source Source

Source organism organism	Schistosoma japonicum
NCBI taxonomy ID ncbi_taxonomy_id	6182
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Tubulin beta chain
Molecular weight formula_weight	49907.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA

Entity 5 Entity 5 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	50121.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,G,E

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

▶

Resolution resolution	4.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	117870

D. melanogaster Augmin TII N-clamp (GST-fusion) bound to a microtubule, well-defined subset of particles

1. Protein Identity and Related Structures Protein Identity & Related Structures

Augmin complex subunit dgt4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Augmin complex subunit dgt6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rpd__assembly_1__model_1

9rpd__assembly_1__model_1 | I(q)

9rpd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)