2jmx

OSCP-NT (1-120) in complex with N-terminal (1-25) alpha subunit from F1-ATPase

Method: SOLUTION NMR D_max: 45.7 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase O subunit, mitochondrial

Bos taurus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 24–143	Fragment：ATP synthase O subunit, residues 1-120	ATP synthase subunit alpha heart isoform, mitochondrial × 1 （P19483）	SOLUTION NMR NMR measurement conditions：pH 6.5；300 K；Ionic strength (raw mmCIF value) 0.5；Pressure ambient NMR sample composition：0.5 mM [U-99% 13C, U-99% 15N] oscp-nt, 1.5 mM alpha-nt, 20 mM sodium phosphate, pH 6.5, 0.5 M NaCl, 0.001% PMSF 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2JMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2BO5 Bovine oligomycin sensitivity conferral protein N-terminal domain Deposited 2005-04-07	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–143（120 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 24-143	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；300 K；Ionic strength (raw mmCIF value) 0.5M NACL, 20MM SODIUM PHOSPHATE；Pressure 1.0 NMR sample composition 7% D2O, 93%H2O	Resolution not provided
2WSS The structure of the membrane extrinsic region of bovine ATP synthase Deposited 2009-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain S 24–213（190 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；MICROBATCH UNDER OIL	Resolution 3.20 Å R-free 0.271
2WSS The structure of the membrane extrinsic region of bovine ATP synthase Deposited 2009-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain W 24–213（190 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；MICROBATCH UNDER OIL	Resolution 3.20 Å R-free 0.271
4B2Q Model of the yeast F1Fo-ATP synthase dimer based on subtomogram average Deposited 2012-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 46 PDB declaration: 46-meric	Chain W 24–143（120 aa） Fragment：RESIDUES 24-143 Chain w 24–143（120 aa） Fragment：RESIDUES 24-143	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6 MG MAGNESIUM ION × 10 ADP ADENOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer 250MM TREHALOSE 10NM TRIS- HCL PH7.4；pH 7.4；250MM TREHALOSE 10NM TRIS- HCL PH7.4 cryo-EM vitrification conditions Cryogen ETHANE；VITRIFICATION 1 -- CRYOGEN- ETHANE, TEMPERATURE- 100, INSTRUMENT- HOMEMADE PLUNGER, METHOD- SINGLE SIDE MANUAL BLOTTING FOR 5 SECONDS.,	Resolution 37.00 Å
5ARA Bovine mitochondrial ATP synthase state 1a Deposited 2015-09-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 24–213（190 aa） Fragment：UNP RESIDUES 24-213	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.40 Å
5ARE Bovine mitochondrial ATP synthase state 1b Deposited 2015-09-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 24–213（190 aa） Fragment：UNP RESIDUES 24-213	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 6.70 Å
5ARH Bovine mitochondrial ATP synthase state 2a Deposited 2015-09-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 24–213（190 aa） Fragment：UNP RESIDUES 24-213	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.20 Å
5ARI Bovine mitochondrial ATP synthase state 2b Deposited 2015-09-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 24–213（190 aa） Fragment：UNP RESIDUES 24-213	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.40 Å
5FIJ Bovine mitochondrial ATP synthase state 2c Deposited 2015-09-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 24–213（190 aa） Fragment：UNP RESIDUES 24-213	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.40 Å
5FIK Bovine mitochondrial ATP synthase state 3a Deposited 2015-09-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 24–213（190 aa） Fragment：UNP RESIDUES 24-213	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 6.40 Å
5FIL Bovine mitochondrial ATP synthase state 3b Deposited 2015-09-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 24–213（190 aa） Fragment：UNP RESIDUES 24-213	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) GLYCEROL, 0.05% (WT/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) GLYCEROL, 0.05% (WT/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.10 Å
6YY0 bovine ATP synthase F1-peripheral stalk domain, state 1 Deposited 2020-05-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain S 24–213（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.23 Å
6Z1R bovine ATP synthase F1-peripheral stalk domain, state 2 Deposited 2020-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain S 24–213（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.29 Å
6Z1U bovine ATP synthase F1c8-peripheral stalk domain, state 3 Deposited 2020-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain S 24–213（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.47 Å
6ZIQ bovine ATP synthase stator domain, state 1 Deposited 2020-06-26	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain S 24–213（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 4.33 Å
6ZIT bovine ATP synthase Stator domain, state 2 Deposited 2020-06-26	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain S 24–213（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.49 Å
6ZIU bovine ATP synthase stator domain, state 3 Deposited 2020-06-26	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain S 24–213（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Th sample was allowed to penetrate through the holey grid support and to distribute to both sides of the grid surface for ~15sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 6.02 Å
6ZPO bovine ATP synthase monomer state 1 (combined) Deposited 2020-07-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain S 24–213（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3 CDL CARDIOLIPIN × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 4.00 Å
6ZQM bovine ATP synthase monomer state 2 (combined) Deposited 2020-07-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain S 24–213（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3 CDL CARDIOLIPIN × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.29 Å
6ZQN bovine ATP synthase monomer state 3 (combined) Deposited 2020-07-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain S 24–213（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3 CDL CARDIOLIPIN × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 4.00 Å
7AJB bovine ATP synthase dimer state1:state1 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7AJC bovine ATP synthase dimer state1:state2 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.90 Å
7AJD bovine ATP synthase dimer state1:state3 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7AJE bovine ATP synthase dimer state2:state1 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.40 Å
7AJF bovine ATP synthase dimer state2:state2 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.45 Å
7AJG bovine ATP synthase dimer state2:state3 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.70 Å
7AJH bovine ATP synthase dimer state3:state1 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.70 Å
7AJI bovine ATP synthase dimer state3:state2 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.40 Å
7AJJ bovine ATP synthase dimer state3:state3 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain AS 24–213（190 aa） Chain S 24–213（190 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 13.10 Å
9W2R Cryo-EM structure of FoF1-ATPase monomer state 1 on the bovine heart submitochondrial particles (FoF1-1) Deposited 2025-07-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain S 24–213（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9W2S Cryo-EM structure of FoF1-ATPase monomer state 3 on the bovine heart submitochondrial particles (FoF1-2) Deposited 2025-07-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain S 24–213（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å

30 other PDB entries and 31 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATPO_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–120； UniProt 24–143

ATP synthase subunit alpha heart isoform, mitochondrial

OrganismNot specified

UniProt P19483

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 44–68	Fragment：ATP synthase subunit alpha heart isoform, residues 1-25	ATP synthase O subunit, mitochondrial × 1 （P13621）	SOLUTION NMR NMR measurement conditions：pH 6.5；300 K；Ionic strength (raw mmCIF value) 0.5；Pressure ambient NMR sample composition：0.5 mM [U-99% 13C, U-99% 15N] oscp-nt, 1.5 mM alpha-nt, 20 mM sodium phosphate, pH 6.5, 0.5 M NaCl, 0.001% PMSF 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 2JMX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BMF BOVINE MITOCHONDRIAL F1-ATPASE Deposited 1996-03-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；pH 8.2	Resolution 2.85 Å
1COW BOVINE MITOCHONDRIAL F1-ATPASE COMPLEXED WITH AUROVERTIN B Deposited 1996-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 45–553（509 aa） Chain B 45–553（509 aa） Chain C 45–553（509 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AUR AUROVERTIN B × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å R-free 0.280
1E1Q BOVINE MITOCHONDRIAL F1-ATPASE AT 100K Deposited 2000-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.00	Resolution 2.61 Å R-free 0.280
1E1R BOVINE MITOCHONDRIAL F1-ATPASE INHIBITED BY MG2+ADP AND ALUMINIUM FLUORIDE Deposited 2000-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AF3 ALUMINUM FLUORIDE × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.00	Resolution 2.50 Å R-free 0.282
1E79 Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide) Deposited 2000-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3 GOL GLYCEROL × 1 DCW DICYCLOHEXYLUREA × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.00	Resolution 2.40 Å R-free 0.281
1EFR BOVINE MITOCHONDRIAL F1-ATPASE COMPLEXED WITH THE PEPTIDE ANTIBIOTIC EFRAPEPTIN Deposited 1996-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 45–553（509 aa） Chain B 45–553（509 aa） Chain C 45–553（509 aa）	Not recorded	MG MAGNESIUM ION × 5 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；PH 8.2	Resolution 3.10 Å R-free 0.220
1H8E (ADP.AlF4)2(ADP.SO4) bovine F1-ATPase (all three catalytic sites occupied) Deposited 2001-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6 GOL GLYCEROL × 4 ALF TETRAFLUOROALUMINATE ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；CRYSTALS WERE GROWN IN THE PRESENCE OF AZIDE, A KNOWN INHIBITOR, BUT THIS HAS NOT BEEN LOCATED IN THE STRUCTURE., pH 8.00	Resolution 2.00 Å R-free 0.264
1H8H Bovine mitochondrial F1-ATPase crystallised in the presence of 5mm AMPPNP Deposited 2001-02-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 GOL GLYCEROL × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；CRYSTALS WERE GROWN IN THE PRESENCE OF AZIDE, A KNOWN INHIBITOR, BUT THIS HAS NOT BEEN LOCATED IN THE STRUCTURE., pH 8.00	Resolution 2.90 Å R-free 0.292
1NBM THE STRUCTURE OF BOVINE F1-ATPASE COVALENTLY INHIBITED WITH 4-CHLORO-7-NITROBENZOFURAZAN Deposited 1998-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	MG MAGNESIUM ION × 5 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；50MM TRIS-HCL, PH7.5, 200MM SODIUM CHLORIDE, 20MM MAGNESIUM SULPHATE, 1MM EDTA, 0.002% (W/V) PHENYL METHYLSULPHONYL FLUORIDE, 0.02%(W/V) SODIUM AZIDE, 10.5% (W/V) PEG MME 5000, 250UM AMP-PNP AND 5UM ADP.	Resolution 3.00 Å R-free 0.297
1OHH BOVINE MITOCHONDRIAL F1-ATPASE complexed with the inhibitor protein IF1 Deposited 2003-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.6；PROTEIN 20MG/ML IN 100MM PIPES-NAOH PH6.6, 40MM MGSO4, 0.04% NA AZIDE, 10% GLYCEROL, 0.002% PMSF. DROPS EQUAL VOLUME OF PROTEIN AND 10MM AMP-PNP, 300MM NACL, 16% PEG 4000, 5MM SPERMIDINE. BATCH METHOD., pH 6.60	Resolution 2.80 Å R-free 0.280
1QO1 Molecular Architecture of the Rotary Motor in ATP Synthase from Yeast Mitochondria Deposited 1999-11-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 67–553（487 aa） Chain B 67–553（487 aa） Chain C 62–553（492 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8；0.1 M TRIS/CL PH8.0, 12% PEG 6000, 150 MM NACL, 1 MM AMP-PNP, 40 MICROM ADP, 1 MM DTT, 0.02% NAN3, MIXED 1:1 WITH PROTEIN SOLUTION UNDER PARAFFIN OIL IN MICROBATCH PLATE., pH 8.00	Resolution 3.90 Å
1W0J Beryllium fluoride inhibited bovine F1-ATPase Deposited 2004-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 GOL GLYCEROL × 4 BEF BERYLLIUM TRIFLUORIDE ION × 2 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；CRYSTALS WERE GROWN IN THE PRESENCE OF AZIDE, A KNOWN INHIBITOR, BUT THIS HAS NOT BEEN LOCATED IN THE STRUCTURE., pH 8.20	Resolution 2.20 Å R-free 0.236
1W0K ADP inhibited bovine F1-ATPase Deposited 2004-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5 GOL GLYCEROL × 3 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；CRYSTALS WERE GROWN IN THE PRESENCE OF AZIDE, A KNOWN INHIBITOR, BUT THIS HAS NOT BEEN LOCATED IN THE STRUCTURE., pH 8.20	Resolution 2.85 Å R-free 0.278
2CK3 Azide inhibited bovine F1-ATPase Deposited 2006-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AZI AZIDE ION × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 250 UM AMP-PNP, 5 UM ADP, 3 MM NAN3, 0.004% (W/V) PHENYLMETHYLSULFONYL FLUORIDE AND 9% (W/V) POLYETHYLENE GLYCOL 6000.	Resolution 1.95 Å R-free 0.226
2JDI Ground state structure of F1-ATPase from bovine heart mitochondria (Bovine F1-ATPase crystallised in the absence of azide) Deposited 2007-01-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 44–553（510 aa） Fragment：RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：RESIDUES 44-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 250 UM AMP-PNP, 5 UM ADP, 0.004% (W/V) PHENYLMETHYLSULFONYL FLUORIDE AND 12% (W/V) POLYETHYLENE GLYCOL 6000	Resolution 1.90 Å R-free 0.220
2JIZ The Structure of F1-ATPase inhibited by resveratrol. Deposited 2007-07-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 45–553（509 aa） Fragment：RESIDUES 44-553 Chain B 45–553（509 aa） Fragment：RESIDUES 44-553 Chain C 45–553（509 aa） Fragment：RESIDUES 44-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 GOL GLYCEROL × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AZI AZIDE ION × 1 PO4 PHOSPHATE ION × 1 STL RESVERATROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；pH 8.2	Resolution 2.30 Å R-free 0.217
2JIZ The Structure of F1-ATPase inhibited by resveratrol. Deposited 2007-07-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 45–553（509 aa） Fragment：RESIDUES 44-553 Chain I 45–553（509 aa） Fragment：RESIDUES 44-553 Chain J 45–553（509 aa） Fragment：RESIDUES 44-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 GOL GLYCEROL × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AZI AZIDE ION × 1 PO4 PHOSPHATE ION × 1 STL RESVERATROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；pH 8.2	Resolution 2.30 Å R-free 0.217
2JJ1 The Structure of F1-ATPase inhibited by piceatannol. Deposited 2007-07-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 45–553（509 aa） Fragment：RESIDUES 44-553 Chain B 45–553（509 aa） Fragment：RESIDUES 44-553 Chain C 45–553（509 aa） Fragment：RESIDUES 44-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 GOL GLYCEROL × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AZI AZIDE ION × 1 PO4 PHOSPHATE ION × 1 PIT PICEATANNOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；pH 8.2	Resolution 2.70 Å R-free 0.269
2JJ1 The Structure of F1-ATPase inhibited by piceatannol. Deposited 2007-07-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 45–553（509 aa） Fragment：RESIDUES 44-553 Chain I 45–553（509 aa） Fragment：RESIDUES 44-553 Chain J 45–553（509 aa） Fragment：RESIDUES 44-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 GOL GLYCEROL × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AZI AZIDE ION × 1 PO4 PHOSPHATE ION × 1 PIT PICEATANNOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；pH 8.2	Resolution 2.70 Å R-free 0.269
2JJ2 The Structure of F1-ATPase inhibited by quercetin. Deposited 2007-07-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 45–553（509 aa） Fragment：RESIDUES 44-553 Chain B 45–553（509 aa） Fragment：RESIDUES 44-553 Chain C 45–553（509 aa） Fragment：RESIDUES 44-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 GOL GLYCEROL × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AZI AZIDE ION × 1 PO4 PHOSPHATE ION × 1 QUE 3,5,7,3',4'-PENTAHYDROXYFLAVONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；pH 8.2	Resolution 2.40 Å R-free 0.238
2JJ2 The Structure of F1-ATPase inhibited by quercetin. Deposited 2007-07-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 45–553（509 aa） Fragment：RESIDUES 44-553 Chain I 45–553（509 aa） Fragment：RESIDUES 44-553 Chain J 45–553（509 aa） Fragment：RESIDUES 44-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 GOL GLYCEROL × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 1 AZI AZIDE ION × 1 PO4 PHOSPHATE ION × 1 QUE 3,5,7,3',4'-PENTAHYDROXYFLAVONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；pH 8.2	Resolution 2.40 Å R-free 0.238
2W6E Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration:hydration state 1. Deposited 2008-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–553（553 aa） Chain B 1–553（553 aa） Chain C 1–553（553 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 1 MM ADP, 1 MM ALCL3, 6 MM NAF 0.004% (W/V)PHENYLMETHYLSULFONYL FLUORIDE AND 12% (W/V) POLYETHYLENE GLYCOL 6000	Resolution 6.50 Å R-free 0.285
2W6F Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration: Hydration State 2. Deposited 2008-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–553（553 aa） Chain B 1–553（553 aa） Chain C 1–553（553 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 1 MM ADP, 1 MM ALCL3, 6 MM NAF 0.004% (W/V)PHENYLMETHYLSULFONYL FLUORIDE AND 12% (W/V) POLYETHYLENE GLYCOL 6000	Resolution 6.00 Å R-free 0.343
2W6G Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration: Hydration State 3. Deposited 2008-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–553（553 aa） Chain B 1–553（553 aa） Chain C 1–553（553 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 1 MM ADP, 1 MM ALCL3, 6 MM NAF 0.004% (W/V)PHENYLMETHYLSULFONYL FLUORIDE AND 12% (W/V) POLYETHYLENE GLYCOL 6000	Resolution 6.00 Å
2W6H Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration: Hydration State 4A. Deposited 2008-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–553（553 aa） Chain B 1–553（553 aa） Chain C 1–553（553 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 1 MM ADP, 1 MM ALCL3, 6 MM NAF 0.004% (W/V)PHENYLMETHYLSULFONYL FLUORIDE AND 12% (W/V) POLYETHYLENE GLYCOL 6000	Resolution 5.00 Å
2W6I Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration: Hydration State 4B. Deposited 2008-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–553（553 aa） Chain B 1–553（553 aa） Chain C 1–553（553 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 1 MM ADP, 1 MM ALCL3, 6 MM NAF 0.004% (W/V)PHENYLMETHYLSULFONYL FLUORIDE AND 12% (W/V) POLYETHYLENE GLYCOL 6000	Resolution 4.00 Å R-free 0.300
2W6J Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration: Hydration State 5. Deposited 2008-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–553（553 aa） Chain B 1–553（553 aa） Chain C 1–553（553 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；50 MM TRIS-HCL PH 8.2, 200 MM NACL, 20 MM MGSO4, 1 MM ADP, 1 MM ALCL3, 6 MM NAF 0.004% (W/V)PHENYLMETHYLSULFONYL FLUORIDE AND 12% (W/V) POLYETHYLENE GLYCOL 6000	Resolution 3.84 Å
2WSS The structure of the membrane extrinsic region of bovine ATP synthase Deposited 2009-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；MICROBATCH UNDER OIL	Resolution 3.20 Å R-free 0.271
2WSS The structure of the membrane extrinsic region of bovine ATP synthase Deposited 2009-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain J 44–553（510 aa） Chain K 44–553（510 aa） Chain L 44–553（510 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；MICROBATCH UNDER OIL	Resolution 3.20 Å R-free 0.271
2XND Crystal structure of bovine F1-c8 sub-complex of ATP Synthase Deposited 2010-08-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain A 62–553（492 aa） Fragment：RESIDUES 62-553 Chain B 62–553（492 aa） Fragment：RESIDUES 62-553 Chain C 62–553（492 aa） Fragment：RESIDUES 62-553	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 GOL GLYCEROL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；CRYSTALS WERE GROWN UNDER OIL BY MIXING EQUAL VOLUMES OF PROTEIN (10MG/ML IN 20MM TRIS PH 8.0, 10% GLYCEROL, 1MM ADP, 1MM AMP-PNP, 2MM MGSO4, 0.02% NAN3, 5.7MM TDM) AND PRECIPITANT SOLUTION (50MM HEPES PH 7.0, 14% PEG4600, 50MM K2HPO4)	Resolution 3.50 Å R-free 0.304
4ASU F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site Deposited 2012-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.289
4TSF The Pathway of Binding of the Intrinsically Disordered Mitochondrial Inhibitor Protein to F1-ATPase Deposited 2014-06-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: Nonameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8.2；295 K；Tris-HCl, PEG 4000, magnesium chloride, EDTA, NaCl, spermidine	Resolution 3.20 Å R-free 0.272
4TT3 The Pathway of Binding of the Intrinsically Disordered Mitochondrial Inhibitor Protein to F1-ATPase Deposited 2014-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: Decameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 GOL GLYCEROL × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8.2；295 K；PEG 4000, Tris-HCl, magnesium chloride, EDTA, ATP, NaCl, spermidine	Resolution 3.21 Å R-free 0.283
4YXW Bovine heart mitochondrial F1-ATPase inhibited by AMP-PNP and ADP in the presence of thiophosphate. Deposited 2015-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 5 MG MAGNESIUM ION × 5 CL CHLORIDE ION × 1 TS6 Monothiophosphate × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICRODIALYSIS；pH 8.2；295 K；PEG 6000, sodium chloride, magnesium chloride, Tris-HCl, AMP-PNP, ADP, sodium monothiophosphate	Resolution 3.10 Å R-free 0.273
4Z1M Bovine F1-ATPase inhibited by three copies of the inhibitor protein IF1 crystallised in the presence of thiophosphate. Deposited 2015-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 GOL GLYCEROL × 2 CL CHLORIDE ION × 11 ADP ADENOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；295 K；Tris.HCl, MgCl2, EDTA, sodium monothiophosphate, ATP NaCl, spermidine, PEG 4000	Resolution 3.30 Å R-free 0.275
5ARA Bovine mitochondrial ATP synthase state 1a Deposited 2015-09-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：UNP RESIDUES 44-553	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.40 Å
5ARE Bovine mitochondrial ATP synthase state 1b Deposited 2015-09-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：UNP RESIDUES 44-553	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 6.70 Å
5ARH Bovine mitochondrial ATP synthase state 2a Deposited 2015-09-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：UNP RESIDUES 44-553	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.20 Å
5ARI Bovine mitochondrial ATP synthase state 2b Deposited 2015-09-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：UNP RESIDUES 44-553	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.40 Å
5FIJ Bovine mitochondrial ATP synthase state 2c Deposited 2015-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：UNP RESIDUES 44-553	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.40 Å
5FIK Bovine mitochondrial ATP synthase state 3a Deposited 2015-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：UNP RESIDUES 44-553	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 6.40 Å
5FIL Bovine mitochondrial ATP synthase state 3b Deposited 2015-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain A 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain B 44–553（510 aa） Fragment：UNP RESIDUES 44-553 Chain C 44–553（510 aa） Fragment：UNP RESIDUES 44-553	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) GLYCEROL, 0.05% (WT/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3；pH 7.2；20 MM TRIS-HCL, 100 MM NACL, 10% (V/V) GLYCEROL, 0.05% (WT/V) DODECYLMALTOSIDE, 2 MM ATP, 0.02% (WT/V) NAN3 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；VITRIFICATION 1 -- CRYOGEN- ETHANE-PROPANE MIXTURE, HUMIDITY- 100, INSTRUMENT- FEI VITROBOT MARK III, METHOD- BLOT FOR 27 SECONDS BEFORE PLUNGING,	Resolution 7.10 Å
6YY0 bovine ATP synthase F1-peripheral stalk domain, state 1 Deposited 2020-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.23 Å
6Z1R bovine ATP synthase F1-peripheral stalk domain, state 2 Deposited 2020-05-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.29 Å
6Z1U bovine ATP synthase F1c8-peripheral stalk domain, state 3 Deposited 2020-05-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.47 Å
6ZIQ bovine ATP synthase stator domain, state 1 Deposited 2020-06-26	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain C 44–553（510 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 4.33 Å
6ZIT bovine ATP synthase Stator domain, state 2 Deposited 2020-06-26	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain C 44–553（510 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.49 Å
6ZIU bovine ATP synthase stator domain, state 3 Deposited 2020-06-26	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 44–553（510 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Th sample was allowed to penetrate through the holey grid support and to distribute to both sides of the grid surface for ~15sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 6.02 Å
6ZPO bovine ATP synthase monomer state 1 (combined) Deposited 2020-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3 CDL CARDIOLIPIN × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 4.00 Å
6ZQM bovine ATP synthase monomer state 2 (combined) Deposited 2020-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3 CDL CARDIOLIPIN × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 3.29 Å
6ZQN bovine ATP synthase monomer state 3 (combined) Deposited 2020-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 3 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 3 CDL CARDIOLIPIN × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；The sample was allowed to penetrate through the holey support and to distribute to both sides of the grid surface for ca. 15 sec. Then the grids were blotted with filter paper for 8-10 sec before blotting.	Resolution 4.00 Å
7AJB bovine ATP synthase dimer state1:state1 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7AJC bovine ATP synthase dimer state1:state2 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.90 Å
7AJD bovine ATP synthase dimer state1:state3 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7AJE bovine ATP synthase dimer state2:state1 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.40 Å
7AJF bovine ATP synthase dimer state2:state2 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.45 Å
7AJG bovine ATP synthase dimer state2:state3 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.70 Å
7AJH bovine ATP synthase dimer state3:state1 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.70 Å
7AJI bovine ATP synthase dimer state3:state2 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.40 Å
7AJJ bovine ATP synthase dimer state3:state3 Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain A 44–553（510 aa） Chain AA 44–553（510 aa） Chain AB 44–553（510 aa） Chain AC 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	CDL CARDIOLIPIN × 6 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 13.10 Å
9W2R Cryo-EM structure of FoF1-ATPase monomer state 1 on the bovine heart submitochondrial particles (FoF1-1) Deposited 2025-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9W2S Cryo-EM structure of FoF1-ATPase monomer state 3 on the bovine heart submitochondrial particles (FoF1-2) Deposited 2025-07-28	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 44–553（510 aa） Chain B 44–553（510 aa） Chain C 44–553（510 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å

58 other PDB entries and 62 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATPA1_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–25； UniProt 44–68

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2jmx
Deposition date deposition_date	2006-12-12
Structure title title	OSCP-NT (1-120) in complex with N-terminal (1-25) alpha subunit from F1-ATPase
Keywords keywords	oscp-nt alpha-nt complex, HYDROLASE; HYDROLASE
Experimental Method method	SOLUTION NMR

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	17.26 Å
Radius of gyration Rg (electron density) rg_electron	17.37 Å
Forward intensity I(0) i0	2973870000.00
Molecular weight molecular_weight	475820.0 kDa
Excluded volume excluded_volume	602980 Å³
Envelope volume envelope_volume	95061 Å³
Hydration-shell volume shell_volume	30972 Å³
Envelope diameter envelope_diameter	86.7 Å
Shell Rg shell_rg	33.01 Å
Envelope Rg envelope_rg	25.91 Å
Shape Rg shape_rg	17.34 Å
Total Rg total_rg	17.78 Å
Total atoms total_atoms	68490
Residues n_residues	4350
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	45.7 Å
Rg (real space) rg_real	16.32 Å
Rg uncertainty (real space) rg_real_error	0.07 Å
I(0) (real space) i0_real	2.8290e+09
I(0) uncertainty (real space) i0_real_error	2.5400e+07
Rg (reciprocal space) rg_reciprocal	17.33 Å
I(0) (reciprocal space) i0_reciprocal	2974000000.0000
Solution quality estimate total_estimate	0.6826
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	19.2 Å
Skewness Skewness skewness	0.267
Kurtosis Kurtosis kurtosis	-0.350
Angular range angular_range	— – 0.4600 Å⁻¹
Current regularization parameter α current_alpha	3.9570
Highest regularization parameter α highest_alpha	511400.0000
Real-space data points n_real_points	77
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.002; Oscil: 0.981; Stabil: 0.978; Sysdev: 0.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	ATP synthase O subunit, mitochondrial
Molecular weight formula_weight	13240.5 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	68490

FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTV

来源 Source

来源生物 organism	Bos taurus
通用名 common_name	cattle
NCBI Class编号 ncbi_taxonomy_id	9913
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit alpha heart isoform, mitochondrial
Molecular weight formula_weight	2634.9 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

QKTGTAEVSSILEERILGADTSVDL

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	2jmxA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	520 — Peroxidase; domain 1
Homologous superfamily homologous superfamily	20 — N-terminal domain of the delta subunit of the F1F0-ATP synthase

▶

8. Citations (1)

▶

fit	/app/data/saxs_computation/jm/2jmx/2jmx.fit
pddf	/app/data/pr_computation/jm/2jmx/2jmx.pr.out
profile	/app/data/saxs_computation/jm/2jmx/2jmx.dat

OSCP-NT (1-120) in complex with N-terminal (1-25) alpha subunit from F1-ATPase

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase O subunit, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit alpha heart isoform, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)