6f1u

N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SL58） Cytoplasmic dynein 1 heavy chain 1 × 3 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 1 （Q13409） BICD family-like cargo adapter 1 × 2 （A0JNT9） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–376； UniProt 1–376 Author chain D； PDBConstruct 1–376； UniProt 1–376 Author chain F； PDBConstruct 1–376； UniProt 1–376

Capping protein (Actin filament) muscle Z-line, alpha 1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	ARP1 actin related protein 1 homolog A × 3 （F2Z5G5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SL58） Cytoplasmic dynein 1 heavy chain 1 × 3 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 1 （Q13409） BICD family-like cargo adapter 1 × 2 （A0JNT9） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0PFK5_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain K； PDBConstruct 1–286； UniProt 1–286

F-actin capping protein beta subunit

OrganismNot specified

UniProt A9XFX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	ARP1 actin related protein 1 homolog A × 3 （F2Z5G5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SL58） Cytoplasmic dynein 1 heavy chain 1 × 3 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 1 （Q13409） BICD family-like cargo adapter 1 × 2 （A0JNT9） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A9XFX6_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain L； PDBConstruct 1–271； UniProt 1–271

Dynactin subunit 2

OrganismNot specified

UniProt F1SKF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	ARP1 actin related protein 1 homolog A × 3 （F2Z5G5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin subunit 2 × 1 （F1SL58） Cytoplasmic dynein 1 heavy chain 1 × 3 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 1 （Q13409） BICD family-like cargo adapter 1 × 2 （A0JNT9） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SKF9_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain c； PDBConstruct 1–50； UniProt 1–50

Dynactin subunit 2

OrganismNot specified

UniProt F1SL58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	ARP1 actin related protein 1 homolog A × 3 （F2Z5G5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin subunit 2 × 1 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 3 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 1 （Q13409） BICD family-like cargo adapter 1 × 2 （A0JNT9） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SL58_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain d； PDBConstruct 1–26； UniProt 1–26

Cytoplasmic dynein 1 heavy chain 1

Homo sapiens

UniProt Q14204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	ARP1 actin related protein 1 homolog A × 3 （F2Z5G5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SL58） Cytoplasmic dynein 1 intermediate chain 2 × 1 （Q13409） BICD family-like cargo adapter 1 × 2 （A0JNT9） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DYHC1_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–1186； UniProt 1–1186 Author chain m； PDBConstruct 1–1186； UniProt 1–1186 Author chain n； PDBConstruct 1–1186； UniProt 1–1186

Cytoplasmic dynein 1 intermediate chain 2

Homo sapiens

UniProt Q13409

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	ARP1 actin related protein 1 homolog A × 3 （F2Z5G5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SL58） Cytoplasmic dynein 1 heavy chain 1 × 3 （Q14204） BICD family-like cargo adapter 1 × 2 （A0JNT9） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DC1I2_HUMAN
Isoform	Q13409-3
PDB entities	7
Chains and sequence ranges	Author chain h； PDBConstruct 1–612； UniProt 1–612

BICD family-like cargo adapter 1

Mus musculus

UniProt A0JNT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	ARP1 actin related protein 1 homolog A × 3 （F2Z5G5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 1 （F1SL58） Cytoplasmic dynein 1 heavy chain 1 × 3 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 1 （Q13409） ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BICL1_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain X； PDBConstruct 1–577； UniProt 1–577 Author chain x； PDBConstruct 1–577； UniProt 1–577

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6f1u
Deposition date deposition_date	2017-11-23
Structure title title	N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1
Keywords keywords	Cryo-EM, Complex, MOTOR PROTEIN, Cargo adaptor; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6f1u__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6f1u__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6f1u__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	66.89 Å
Rg (electron density)	66.97 Å
Total Rg	66.86 Å
Atom count	28866
Residues	3555
Excluded volume	512350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6f1u__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	ARP1 actin related protein 1 homolog A
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F
Atom count atom_count	28866

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 2 Entity 2 polymer

Description description	Capping protein (Actin filament) muscle Z-line, alpha 1
Molecular weight formula_weight	33059.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 3 Entity 3 polymer

Description description	F-actin capping protein beta subunit
Molecular weight formula_weight	30566.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ

Entity 4 Entity 4 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	5582.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALQEELTSTSVEHIIV

Entity 5 Entity 5 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	2880.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MADPKYADLPGIARNEPDVYETSDLP

Entity 6 Entity 6 polymer

Description description	Cytoplasmic dynein 1 heavy chain 1
Molecular weight formula_weight	136786.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,m,n

MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVSEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 7 Entity 7 polymer

Description description	Cytoplasmic dynein 1 intermediate chain 2
Molecular weight formula_weight	68442.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREAEALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWSTKNNKPLYSFEDNAGYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 8 Entity 8 polymer

Description description	BICD family-like cargo adapter 1
Molecular weight formula_weight	65377.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

MSAFCLGLAGRASAPAEPDSACCMELPAGAGDAVRSPATAAALVSFPGGPGELELALEEELALLAAGERSSEPGEHPQAEPESPVEGHGPPLPPPPTQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELETDVKQLQDELERQQLHLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALKEDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQGHDKDLQLHQSQLELQEVRLSYRQLQGKVEELTEERSLQSSAATSTSLLSEIEQSMEAEELEQEREQLRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNDLKRLIQSIVDGVEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQLQKAIRDRDEAIAKKNAVELELAKCKMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLKEQSRPAAAAFPRGHGVGRGQEPSTADGKRLFSFFRKI

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 9 Entity 9 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 13 domains

CATH v4.4 (13 domains)

Domain ID domain_id	6f1uB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1uB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1uB03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1uD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1uD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1uD03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1uF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1uF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	6f1uF03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	6f1uK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	6f1uK02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	6f1uL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	6f1uL02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	205611

N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capping protein (Actin filament) muscle Z-line, alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin capping protein beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytoplasmic dynein 1 heavy chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytoplasmic dynein 1 intermediate chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BICD family-like cargo adapter 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6f1u__assembly_1__model_1

6f1u__assembly_1__model_1 | I(q)

6f1u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer