6znn

The pointed end complex of dynactin bound to Hook3

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Dynactin subunit 2 × 1 （A0A5G2QD80） putative Hook3 coiled coil × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Hook3 × 1 Dynactin subunit 4 × 1 （A0A4X1TB62） Hook3 × 1 ADENOSINE-5'-DIPHOSPHATE × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain I； PDBConstruct 1–376； UniProt 1–376

Actin, cytoplasmic 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Arp11 × 1 （I3LHK5） Dynactin subunit 2 × 1 （A0A5G2QD80） putative Hook3 coiled coil × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Hook3 × 1 Dynactin subunit 4 × 1 （A0A4X1TB62） Hook3 × 1 ADENOSINE-5'-DIPHOSPHATE × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375

Arp11

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Dynactin subunit 2 × 1 （A0A5G2QD80） putative Hook3 coiled coil × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Hook3 × 1 Dynactin subunit 4 × 1 （A0A4X1TB62） Hook3 × 1 ADENOSINE-5'-DIPHOSPHATE × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–417； UniProt 1–417

Dynactin subunit 2

OrganismNot specified

UniProt A0A5G2QD80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） putative Hook3 coiled coil × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Hook3 × 1 Dynactin subunit 4 × 1 （A0A4X1TB62） Hook3 × 1 ADENOSINE-5'-DIPHOSPHATE × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2QD80_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain M； PDBConstruct 1–405； UniProt 1–405

Dynactin 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Dynactin subunit 2 × 1 （A0A5G2QD80） putative Hook3 coiled coil × 2 Dynactin subunit 5 × 1 （A0A286ZK88） Hook3 × 1 Dynactin subunit 4 × 1 （A0A4X1TB62） Hook3 × 1 ADENOSINE-5'-DIPHOSPHATE × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain U； PDBConstruct 1–190； UniProt 1–190

Dynactin subunit 5

OrganismNot specified

UniProt A0A286ZK88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Dynactin subunit 2 × 1 （A0A5G2QD80） putative Hook3 coiled coil × 2 Dynactin 6 × 1 （D0G6S1） Hook3 × 1 Dynactin subunit 4 × 1 （A0A4X1TB62） Hook3 × 1 ADENOSINE-5'-DIPHOSPHATE × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZK88_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain V； PDBConstruct 1–182； UniProt 1–182

Dynactin subunit 4

OrganismNot specified

UniProt A0A4X1TB62

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Arp11 × 1 （I3LHK5） Dynactin subunit 2 × 1 （A0A5G2QD80） putative Hook3 coiled coil × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Hook3 × 1 Hook3 × 1 ADENOSINE-5'-DIPHOSPHATE × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TB62_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Y； PDBConstruct 1–467； UniProt 1–467

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6znn
Deposition date deposition_date	2020-07-06
Structure title title	The pointed end complex of dynactin bound to Hook3
Keywords keywords	Dynactin, Complex, Scaffold, Cytoskeleton, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6znn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6znn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6znn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.86 Å
Rg (electron density)	53.12 Å
Total Rg	52.95 Å
Atom count	19457
Residues	2641
Excluded volume	344710 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6znn__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	ARP1 actin related protein 1 homolog A
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,I
Atom count atom_count	19457

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 2 Entity 2 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 3 Entity 3 polymer

Description description	Arp11
Molecular weight formula_weight	46250.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Entity 4 Entity 4 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	44704.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKMTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNTKGAGSGGKTTSGSPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIACSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK

Entity 5 Entity 5 polymer

Description description	putative Hook3 coiled coil
Molecular weight formula_weight	5805.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	Dynactin 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 7 Entity 7 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	20150.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 8 Entity 8 polymer

Description description	Hook3
Molecular weight formula_weight	7932.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 9 Entity 9 polymer

Description description	Dynactin subunit 4
Molecular weight formula_weight	52920.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTAVKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPDHPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQHTIHVVDKYGLGTRLQRPRAGTTITALAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRQCEHNLSKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDDTNSTAKVSVPPTELVLAGKDAAAEYDELAEPQDFPDDPDVVAFRKANKVGVFIKVTPQREEGDVTVCFKLKHDFKNLAAPIRPVEEADPGAEVSWLTQHVELSLGPLLP

Entity 10 Entity 10 polymer

Description description	Hook3
Molecular weight formula_weight	7847.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 11 Entity 11 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 12 Entity 12 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	57348

The pointed end complex of dynactin bound to Hook3

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Arp11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6znn__assembly_1__model_1

6znn__assembly_1__model_1 | I(q)

6znn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer