9dgv

structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alpha-centractin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1PMN0_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–376； UniProt 1–376 Author chain B； PDBConstruct 1–376； UniProt 1–376 Author chain C； PDBConstruct 1–376； UniProt 1–376 Author chain D； PDBConstruct 1–376； UniProt 1–376 Author chain E； PDBConstruct 1–376； UniProt 1–376 Author chain F； PDBConstruct 1–376； UniProt 1–376 Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain I； PDBConstruct 1–376； UniProt 1–376

Actin, cytoplasmic 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375

Actin-related protein 10

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP10_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–417； UniProt 1–417

F-actin-capping protein subunit alpha-1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAZA1_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–286； UniProt 1–286

F-actin-capping protein subunit beta

OrganismNot specified

UniProt A0PFK7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPZB_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–272； UniProt 1–272

Dynactin subunit 2

OrganismNot specified

UniProt A0A5G2QD80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN2_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–405； UniProt 1–405 Author chain N； PDBConstruct 1–405； UniProt 1–405 Author chain P； PDBConstruct 1–405； UniProt 1–405 Author chain Q； PDBConstruct 1–405； UniProt 1–405

Dynactin subunit 3

OrganismNot specified

UniProt F1SEC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN3_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain O； PDBConstruct 1–186； UniProt 1–186 Author chain R； PDBConstruct 1–186； UniProt 1–186

Dynactin subunit 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN6_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain U； PDBConstruct 1–190； UniProt 1–190

Dynactin subunit 5

OrganismNot specified

UniProt A0A286ZK88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN5_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain V； PDBConstruct 1–182； UniProt 1–182

Dynactin subunit 1

OrganismNot specified

UniProt A0A287B8J2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN1_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain W； PDBConstruct 1–1281； UniProt 1–1281 Author chain Z； PDBConstruct 1–1281； UniProt 1–1281

Dynactin subunit 4

OrganismNot specified

UniProt A0A4X1TB62

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN4_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Y； PDBConstruct 1–467； UniProt 1–467

Trafficking protein, kinesin binding 2

Mus musculus

UniProt Q6P9N8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6P9N8_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain a； PDBConstruct 1–913； UniProt 1–913 Author chain b； PDBConstruct 1–913； UniProt 1–913

Cytoplasmic dynein 1 heavy chain 1

OrganismNot specified

UniProt A0A480I0V8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 intermediate chain 2 × 4 （A0A4X1VH50） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480I0V8_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain e； PDBConstruct 1–4646； UniProt 1–4646 Author chain f； PDBConstruct 1–4646； UniProt 1–4646 Author chain m； PDBConstruct 1–4646； UniProt 1–4646 Author chain n； PDBConstruct 1–4646； UniProt 1–4646

Cytoplasmic dynein 1 intermediate chain 2

OrganismNot specified

UniProt A0A4X1VH50

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Alpha-centractin × 8 （A0A8D1PMN0） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin-related protein 10 × 1 （I3LHK5） F-actin-capping protein subunit alpha-1 × 1 （A0PFK5） F-actin-capping protein subunit beta × 1 （A0PFK7） Dynactin subunit 2 × 4 （A0A5G2QD80） Dynactin subunit 3 × 2 （F1SEC0） Dynactin subunit 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin subunit 1 × 2 （A0A287B8J2） Dynactin subunit 4 × 1 （A0A4X1TB62） Trafficking protein, kinesin binding 2 × 2 （Q6P9N8） Cytoplasmic dynein 1 heavy chain 1 × 4 （A0A480I0V8） ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VH50_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain g； PDBConstruct 1–612； UniProt 1–612 Author chain h； PDBConstruct 1–612； UniProt 1–612 Author chain o； PDBConstruct 1–612； UniProt 1–612 Author chain p； PDBConstruct 1–612； UniProt 1–612

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9dgv
Deposition date deposition_date	2024-09-03
Structure title title	structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules
Keywords keywords	dynein, TRAK2, dynactin, microtubule, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9dgv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9dgv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9dgv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	111.30 Å
Total Rg	111.40 Å
Atom count	86528
Residues	11794
Excluded volume	1519600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9dgv__assembly_1__model_1`	33-meric （33）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Alpha-centractin
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,I
Atom count atom_count	86528

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 2 Entity 2 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 3 Entity 3 polymer

Description description	Actin-related protein 10
Molecular weight formula_weight	46250.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Entity 4 Entity 4 polymer

Description description	F-actin-capping protein subunit alpha-1
Molecular weight formula_weight	33059.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 5 Entity 5 polymer

Description description	F-actin-capping protein subunit beta
Molecular weight formula_weight	30669.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Entity 6 Entity 6 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	44704.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,P,Q

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKMTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNTKGAGSGGKTTSGSPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIACSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK

Entity 7 Entity 7 polymer

Description description	Dynactin subunit 3
Molecular weight formula_weight	21192.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,R

MAGVTDVQRLQARLEELERWVYGPGGSRGSRKVADGLVKVQVALGNIASKRERVKILYKKIEDLIKYLDPEYMDRIAIPDASKLQFILAEEQFILSQVALLEQVEALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAAKQVKPAEE

Entity 8 Entity 8 polymer

Description description	Dynactin subunit 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 9 Entity 9 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	20150.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 10 Entity 10 polymer

Description description	Dynactin subunit 1
Molecular weight formula_weight	142015.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,Z

MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLRREGTDSNAKTSKLRGPKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEASDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGAQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGIRGPPPSGIATLVSGIAGEEQQRGGAPGQAPGIVPGPGLVKDSPLLLQQISAMRLHISQLQHENSVLKGAQMKASLAALPPLHVAKLSLPPHEGPGSELAAGALYRKTNQLLETLNQLSTHTHVVDITRSSPAAKSPSAQLLEQVTQLKSLSDTIEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLGQRHRLVLTQEQLHQLHDRLIS

Entity 11 Entity 11 polymer

Description description	Dynactin subunit 4
Molecular weight formula_weight	52920.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTAVKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPDHPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQHTIHVVDKYGLGTRLQRPRAGTTITALAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRQCEHNLSKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDDTNSTAKVSVPPTELVLAGKDAAAEYDELAEPQDFPDDPDVVAFRKANKVGVFIKVTPQREEGDVTVCFKLKHDFKNLAAPIRPVEEADPGAEVSWLTQHVELSLGPLLP

Entity 12 Entity 12 polymer

Description description	Trafficking protein, kinesin binding 2
Molecular weight formula_weight	101418.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b

MSQSQNAIFKSRTGEANLMSSNHRDSESITDVCSNEDLPEVELVNLLEEQLPQYKLRVDSLFLYENQDWAQSSHQQQDAPETLSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHVLSEQNEALEEQLGQAFDQVNQLQHELSKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLDMLHEKLRELEEENMALRSKACHIKTETFTYEEKEQQLVNDCVKELRETNAQMSRMTEELSGKSDELLRYQEEISSLLSQIVDLQHKLKEHVIEKEELRLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSKSGPSAHLCFSQSYGVFTGESLAAEIEGTMRKKLSLDEESVSKQKAQQKRVFDTVKVANDTRGRSVTFPVLLPIPGSNRSSVIMTAKPFESGVQPAEDKTLLSPGGSTEVPGNSQPTNPPGSPEDSDLATALHRLSLRRQNYLSEKQFFAEEWERKIQILAEQEEEVSSCDAPTENLASVCTDQSETTDLGSASCLRGFMPEKLQIVKPLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTQVPKDVVYHISDLEEDEEEGITFQVQQPLQLEQKPALPTPVTGIFLPPMTSAGGPGTVATSNPGKCLSFTNSTFTFTTCRILHPSDITQVTPSSGFPSLACGSSASSSSNTAVNSPAASYRLSIGESITNRRDSTITFSSTRSLAKLLQERGISAKVYHSPASENPLLQPCPKALATPSTPPNSPAQSPCSSPLPFEPRVHVSENFLASRPAETFLQEMYGLRPSRAPPDVGQLKMNLVDRLKRLGIARVVKTPDPQENGKSREAEMGLQKPDPAVYLNSGGSLLCGLRRNQSLPVMMGSFGAPVCTTSPKMGILKED

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	Cytoplasmic dynein 1 heavy chain 1
Molecular weight formula_weight	532739.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,m,n

MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRAPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQGEAPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFAIESTRVRGRSGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDDLLIIEEKIDLEVRSLETCVYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQRFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLADWEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTETGLLSGSEERVQVALEELQDLKGVWSELSKIWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARLRQYASYEFVQRLLKGYLKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKNEAVVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILSEDNSVVLGISSREGEEVTFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYITWIDKYQAQLVVLSAQIAWSENVEAALSSIGGSGDSAPLQSVLSNVEVTLNVLADSVLMEQPPLRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCIQEALREHSSPNHDKASAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSAGNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGLMMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDNVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRIMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKGKEDEGEEAASPMLQIQRDAATTLQPYFTPNGLVTKALEHAFKLEHIMDLTRLRCLGSLFSMLHQACRNVAQYNANHPDFPMQMEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRRITTVPLPAAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLVPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEGLIRIWAHEALRLFQDRLVEDEERRWTDENIDLVALKHFPNIDKEKAMSRPILYSNWLSKDYIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNYVVPDYMPVVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFINHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEVTRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYHNVLYENPNLKGVTDHTQRLCIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTVGEPTYEAEFQHFLRGKEIVLSAGSTPKIPGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFSIWLDSSSPEQTVPHLWSEENPATPIGQAIHRLLLIQAFRPDRLLAMAHVFVSTNLGESFMSIMEQPLDLTHIVDTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFNQADKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGVKANMLRTFSSVPVSRICKSPNERARLYFLLAWFHAIIQERLRYAPLGWSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEFDQRLLNTFLERLFTTRSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDTQTPSWLGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKTRTDSTADGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVDNIKDPLFRFFEREVKMGARLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQSVSQAAASGGAKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVIVTTSQSATLDACSFGVTGLKLQGATCSNNKLSLSNAISTVLPLTQLRWVKQTNAEKKANVVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYERGVAVLCTE

Entity 14 Entity 14 polymer

Description description	Cytoplasmic dynein 1 intermediate chain 2
Molecular weight formula_weight	68567.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,o,p

MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVTSVQEESDLEKKRREAEALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEEDDVVTPKPPIEPEEEKTLKKDEESDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

Entity 15 Entity 15 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 16 Entity 16 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	8.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	52920

structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alpha-centractin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin-capping protein subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin-capping protein subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer