7z8m

The pointed end complex of dynactin bound to BICDR1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dynactin subunit 2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 4 × 1 （A0A4X1TB62） Arp11 × 1 （I3LHK5） ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Dynactin subunit 5 × 1 （A0A286ZK88） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1W6J2_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain M； PDBConstruct 1–405； UniProt 1–405

BICD family-like cargo adapter 1

Mus musculus

UniProt A0JNT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Dynactin subunit 2 × 1 （A0A4X1W6J2） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 4 × 1 （A0A4X1TB62） Arp11 × 1 （I3LHK5） ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Dynactin subunit 5 × 1 （A0A286ZK88） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BICL1_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain X； PDBConstruct 1–577； UniProt 1–577

Dynactin 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Dynactin subunit 2 × 1 （A0A4X1W6J2） BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin subunit 4 × 1 （A0A4X1TB62） Arp11 × 1 （I3LHK5） ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Dynactin subunit 5 × 1 （A0A286ZK88） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain U； PDBConstruct 1–190； UniProt 1–190

Dynactin subunit 4

OrganismNot specified

UniProt A0A4X1TB62

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Dynactin subunit 2 × 1 （A0A4X1W6J2） BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin 6 × 1 （D0G6S1） Arp11 × 1 （I3LHK5） ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Dynactin subunit 5 × 1 （A0A286ZK88） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TB62_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Y； PDBConstruct 1–467； UniProt 1–467

Arp11

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Dynactin subunit 2 × 1 （A0A4X1W6J2） BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 4 × 1 （A0A4X1TB62） ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Dynactin subunit 5 × 1 （A0A286ZK88） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain J； PDBConstruct 1–417； UniProt 1–417

ARP1 actin related protein 1 homolog A

OrganismNot specified

UniProt F2Z5G5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Dynactin subunit 2 × 1 （A0A4X1W6J2） BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 4 × 1 （A0A4X1TB62） Arp11 × 1 （I3LHK5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Dynactin subunit 5 × 1 （A0A286ZK88） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain I； PDBConstruct 1–376； UniProt 1–376

Actin, cytoplasmic 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Dynactin subunit 2 × 1 （A0A4X1W6J2） BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 4 × 1 （A0A4X1TB62） Arp11 × 1 （I3LHK5） ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Dynactin subunit 5 × 1 （A0A286ZK88） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375

Dynactin subunit 5

OrganismNot specified

UniProt A0A286ZK88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Dynactin subunit 2 × 1 （A0A4X1W6J2） BICD family-like cargo adapter 1 × 1 （A0JNT9） Dynactin 6 × 1 （D0G6S1） Dynactin subunit 4 × 1 （A0A4X1TB62） Arp11 × 1 （I3LHK5） ARP1 actin related protein 1 homolog A × 2 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） ZINC ION × 3 ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZK88_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain V； PDBConstruct 1–182； UniProt 1–182

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7z8m
Deposition date deposition_date	2022-03-17
Structure title title	The pointed end complex of dynactin bound to BICDR1
Keywords keywords	Dynein, dynactin, cargo transport, activating adaptor, cytoskeleton, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7z8m__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7z8m__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7z8m__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.17 Å
Rg (electron density)	51.71 Å
Total Rg	51.66 Å
Atom count	17694
Residues	2272
Excluded volume	315970 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7z8m__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	44703.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M
Atom count atom_count	17694

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALQEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKMTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNTKGAGSGGKTTSGSPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIACSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK

Entity 2 Entity 2 polymer

Description description	BICD family-like cargo adapter 1
Molecular weight formula_weight	65377.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSAFCLGLAGRASAPAEPDSACCMELPAGAGDAVRSPATAAALVSFPGGPGELELALEEELALLAAGERSSEPGEHPQAEPESPVEGHGPPLPPPPTQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELETDVKQLQDELERQQLHLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALKEDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQGHDKDLQLHQSQLELQEVRLSYRQLQGKVEELTEERSLQSSAATSTSLLSEIEQSMEAEELEQEREQLRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNDLKRLIQSIVDGVEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQLQKAIRDRDEAIAKKNAVELELAKCKMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLKEQSRPAAAAFPRGHGVGRGQEPSTADGKRLFSFFRKI

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Dynactin 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 4 Entity 4 polymer

Description description	Dynactin subunit 4
Molecular weight formula_weight	52920.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTAVKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPDHPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQHTIHVVDKYGLGTRLQRPRAGTTITALAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRQCEHNLSKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDDTNSTAKVSVPPTELVLAGKDAAAEYDELAEPQDFPDDPDVVAFRKANKVGVFIKVTPQREEGDVTVCFKLKHDFKNLAAPIRPVEEADPGAEVSWLTQHVELSLGPLLP

Entity 5 Entity 5 polymer

Description description	Arp11
Molecular weight formula_weight	46250.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Entity 6 Entity 6 polymer

Description description	ARP1 actin related protein 1 homolog A
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,I

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 7 Entity 7 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 8 Entity 8 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	20150.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 9 Entity 9 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 10 Entity 10 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 12 Entity 12 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7z8mG01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	7z8mH01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	7z8mI01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	7z8mJ01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	7z8mU01
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	10 — Hexapeptide repeat proteins

Domain ID domain_id	7z8mV01
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	10 — Hexapeptide repeat proteins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.37 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	165019

The pointed end complex of dynactin bound to BICDR1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BICD family-like cargo adapter 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Arp11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ARP1 actin related protein 1 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7z8m__assembly_1__model_1

7z8m__assembly_1__model_1 | I(q)

7z8m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer