6f3a

Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–376； UniProt 1–376 Author chain B； PDBConstruct 1–376； UniProt 1–376 Author chain C； PDBConstruct 1–376； UniProt 1–376 Author chain D； PDBConstruct 1–376； UniProt 1–376 Author chain E； PDBConstruct 1–376； UniProt 1–376 Author chain F； PDBConstruct 1–376； UniProt 1–376 Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain I； PDBConstruct 1–376； UniProt 1–376

Actin, cytoplasmic 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375

Actin related protein 10 homolog

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–390； UniProt 1–390

Capping protein (Actin filament) muscle Z-line, alpha 1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0PFK5_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–286； UniProt 1–286

F-actin capping protein beta subunit

OrganismNot specified

UniProt A9XFX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A9XFX6_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–272； UniProt 1–272

Dynactin 6

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–190； UniProt 1–190

Dynactin subunit 5

OrganismNot specified

UniProt A0A286ZK88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZK88_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain V； PDBConstruct 1–182； UniProt 1–182

Dynactin subunit 2

OrganismNot specified

UniProt F1SKF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SKF9_PIG
Isoform	—
PDB entities	14, 15
Chains and sequence ranges	Author chain a； PDBConstruct 1–68； UniProt 1–68 Author chain b； PDBConstruct 1–89； UniProt 1–89 Author chain c； PDBConstruct 1–89； UniProt 1–89 Author chain d； PDBConstruct 1–89； UniProt 1–89

Cytoplasmic dynein 1 heavy chain 1

Homo sapiens

UniProt Q14204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DYHC1_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain e； PDBConstruct 1–1455； UniProt 1–1455 Author chain f； PDBConstruct 1–1455； UniProt 1–1455

Cytoplasmic dynein 1 intermediate chain 2

Homo sapiens

UniProt Q13409

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DC1I2_HUMAN
Isoform	Q13409-3
PDB entities	17
Chains and sequence ranges	Author chain g； PDBConstruct 1–612； UniProt 1–612 Author chain h； PDBConstruct 1–612； UniProt 1–612

Cytoplasmic dynein 1 light intermediate chain 2

Homo sapiens

UniProt O43237

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Dynein light chain roadblock-type 1 × 2 （Q9NP97） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DC1L2_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain j； PDBConstruct 1–492； UniProt 1–492

Dynein light chain roadblock-type 1

Homo sapiens

UniProt Q9NP97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	ARP1 actin related protein 1 homolog A × 8 （F2Z5G5） Actin, cytoplasmic 1 × 1 （Q6QAQ1） Actin related protein 10 homolog × 1 （I3LHK5） Capping protein (Actin filament) muscle Z-line, alpha 1 × 1 （A0PFK5） F-actin capping protein beta subunit × 1 （A9XFX6） Dynactin Subunit 2 × 1 Dynactin Subunit 2 × 1 Dynactin Subunit 3 × 2 Dynactin Subunit 2 × 2 Dynactin 6 × 1 （D0G6S1） Dynactin subunit 5 × 1 （A0A286ZK88） Dynactin Subunit 4 × 1 Dynactin Subunit 1 × 1 Dynactin subunit 2 × 1 （F1SKF9） Dynactin subunit 2 × 3 （F1SKF9） Cytoplasmic dynein 1 heavy chain 1 × 2 （Q14204） Cytoplasmic dynein 1 intermediate chain 2 × 2 （Q13409） Cytoplasmic dynein 1 light intermediate chain 2 × 1 （O43237） Dynactin Subunit 1 × 1 BICD2N × 2 ADENOSINE-5'-DIPHOSPHATE × 9 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DLRB1_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain k； PDBConstruct 1–96； UniProt 1–96 Author chain l； PDBConstruct 1–96； UniProt 1–96

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6f3a
Deposition date deposition_date	2017-11-28
Structure title title	Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N
Keywords keywords	TDB, dynein/dynactin/BICD2, complex, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6f3a__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6f3a__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6f3a__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	97.74 Å
Rg (electron density)	99.40 Å
Total Rg	99.14 Å
Atom count	48864
Residues	9811
Excluded volume	787700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6f3a__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	ARP1 actin related protein 1 homolog A
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,I
Atom count atom_count	48864

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 2 Entity 2 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 3 Entity 3 polymer

Description description	Actin related protein 10 homolog
Molecular weight formula_weight	43203.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSL

Entity 4 Entity 4 polymer

Description description	Capping protein (Actin filament) muscle Z-line, alpha 1
Molecular weight formula_weight	33059.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 5 Entity 5 polymer

Description description	F-actin capping protein beta subunit
Molecular weight formula_weight	30669.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Entity 6 Entity 6 polymer

Description description	Dynactin Subunit 2
Molecular weight formula_weight	49974.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 7 Entity 7 polymer

Description description	Dynactin Subunit 2
Molecular weight formula_weight	52442.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

Entity 8 Entity 8 polymer

Description description	Dynactin Subunit 3
Molecular weight formula_weight	5549.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 9 Entity 9 polymer

Description description	Dynactin Subunit 2
Molecular weight formula_weight	7422.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	Dynactin 6
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 11 Entity 11 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	20150.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 12 Entity 12 polymer

Description description	Dynactin Subunit 4
Molecular weight formula_weight	22485.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

Entity 13 Entity 13 polymer

Description description	Dynactin Subunit 1
Molecular weight formula_weight	4443.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 14 Entity 14 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	7578.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALQEELTSTSVEHIIVNPNAAYDKFKDKRVGTKG

Entity 15 Entity 15 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	10015.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c,d

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALQEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYE

Entity 16 Entity 16 polymer

Description description	Cytoplasmic dynein 1 heavy chain 1
Molecular weight formula_weight	168318.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f

MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVSEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQRFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTDWEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQVALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDALLNQLKSFPARLRQYASYEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKNEAIVKDVLLVAQG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 17 Entity 17 polymer

Description description	Cytoplasmic dynein 1 intermediate chain 2
Molecular weight formula_weight	68442.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h

MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREAEALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWSTKNNKPLYSFEDNAGYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 18 Entity 18 polymer

Description description	Cytoplasmic dynein 1 light intermediate chain 2
Molecular weight formula_weight	54173.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 19 Entity 19 polymer

Description description	Dynein light chain roadblock-type 1
Molecular weight formula_weight	10934.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,l

MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 20 Entity 20 polymer

Description description	Dynactin Subunit 1
Molecular weight formula_weight	4528.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 21 Entity 21 polymer

Description description	BICD2N
Molecular weight formula_weight	23421.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6

Source Source

Source organism organism	Mus musculus
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 22 Entity 22 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 23 Entity 23 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	8.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	85744

Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARP1 actin related protein 1 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin related protein 10 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capping protein (Actin filament) muscle Z-line, alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin capping protein beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytoplasmic dynein 1 heavy chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytoplasmic dynein 1 intermediate chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer