5adx

CryoEM structure of dynactin complex at 4.0 angstrom resolution

Method: ELECTRON MICROSCOPY D_max: 273.0 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ACTIN RELATED PROTEIN 1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain A； UniProt 7–376 Chain B； UniProt 7–376 Chain C； UniProt 7–376 Chain D； UniProt 7–376 Chain E； UniProt 7–376 Chain F； UniProt 7–376 Chain G； UniProt 7–376 Chain I； UniProt 7–376	Not recorded	ACTIN, CYTOPLASMIC 1 × 1 （Q6QAQ1） ACTIN RELATED PROTEIN 11 × 1 （I3LHK5） CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1 × 1 （A0PFK5） F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II × 1 （D2JYW4） DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 3 × 2 DYNACTIN SUBUNIT 2 × 2 DYNACTIN 5 × 1 （D0G6S1） DYNACTIN SUBUNIT 6 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 2 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1	ELECTRON MICROSCOPY cryo-EM buffer：50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions：Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5ADX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain A 7–376（370 aa） Chain B 7–376（370 aa） Chain C 7–376（370 aa） Chain D 7–376（370 aa） Chain E 7–376（370 aa） Chain F 7–376（370 aa） Chain G 7–376（370 aa） Chain I 7–376（370 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
5NW4 Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2 Deposited 2017-05-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain G 1–376（376 aa） Chain H 1–376（376 aa） Chain O 1–376（376 aa） Chain P 1–376（376 aa） Chain Q 1–376（376 aa） Chain T 1–376（376 aa） Chain U 1–376（376 aa） Chain W 1–376（376 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F1U N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1 Deposited 2017-11-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain B 1–376（376 aa） Chain D 1–376（376 aa） Chain F 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6ZNM The pointed end complex of dynactin bound to BICDR1 Deposited 2020-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6ZNN The pointed end complex of dynactin bound to Hook3 Deposited 2020-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6ZNO The pointed end complex of dynactin with the p150 projection docked Deposited 2020-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
6ZO4 The pointed end complex of dynactin bound to BICD2 Deposited 2020-07-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8I The barbed end complex of dynactin bound to BICDR1 and the cytoplasmic dynein tails (A2, B1, B2) Deposited 2022-03-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.30 Å
7Z8K Cytoplasmic dynein (A1) bound to BICDR1 Deposited 2022-03-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–376（376 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 4.37 Å
7Z8M The pointed end complex of dynactin bound to BICDR1 Deposited 2022-03-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ZN ZINC ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.37 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain A 1–376（376 aa） Chain B 1–376（376 aa） Chain C 1–376（376 aa） Chain D 1–376（376 aa） Chain E 1–376（376 aa） Chain F 1–376（376 aa） Chain G 1–376（376 aa） Chain I 1–376（376 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å

17 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F2Z5G5_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–370； UniProt 7–376 Author chain B； PDBConstruct 1–370； UniProt 7–376 Author chain C； PDBConstruct 1–370； UniProt 7–376 Author chain D； PDBConstruct 1–370； UniProt 7–376 Author chain E； PDBConstruct 1–370； UniProt 7–376 Author chain F； PDBConstruct 1–370； UniProt 7–376 Author chain G； PDBConstruct 1–370； UniProt 7–376 Author chain I； PDBConstruct 1–370； UniProt 7–376

ACTIN, CYTOPLASMIC 1

OrganismNot specified

UniProt Q6QAQ1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain H； UniProt 6–375	Not recorded	ACTIN RELATED PROTEIN 1 × 8 （F2Z5G5） ACTIN RELATED PROTEIN 11 × 1 （I3LHK5） CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1 × 1 （A0PFK5） F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II × 1 （D2JYW4） DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 3 × 2 DYNACTIN SUBUNIT 2 × 2 DYNACTIN 5 × 1 （D0G6S1） DYNACTIN SUBUNIT 6 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 2 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1	ELECTRON MICROSCOPY cryo-EM buffer：50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions：Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5ADX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain H 6–375（370 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6ZNM The pointed end complex of dynactin bound to BICDR1 Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6ZNN The pointed end complex of dynactin bound to Hook3 Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6ZNO The pointed end complex of dynactin with the p150 projection docked Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
6ZO4 The pointed end complex of dynactin bound to BICD2 Deposited 2020-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8M The pointed end complex of dynactin bound to BICDR1 Deposited 2022-03-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–375（375 aa）	Not recorded	ZN ZINC ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.37 Å
8IAH Structure of mammalian spectrin-actin junctional complex of membrane skeleton, State I, Global map Deposited 2023-02-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–375（375 aa） Chain B 1–375（375 aa） Chain C 1–375（375 aa） Chain D 1–375（375 aa） Chain E 1–375（375 aa） Chain F 1–375（375 aa） Chain G 1–375（375 aa） Chain H 1–375（375 aa） Chain I 1–375（375 aa） Chain J 1–375（375 aa） Chain K 1–375（375 aa） Chain L 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8IAI Structure of mammalian spectrin-actin junctional complex of membrane skeleton, State II, Global map Deposited 2023-02-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain A 1–375（375 aa） Chain B 1–375（375 aa） Chain C 1–375（375 aa） Chain D 1–375（375 aa） Chain E 1–375（375 aa） Chain F 1–375（375 aa） Chain G 1–375（375 aa） Chain H 1–375（375 aa） Chain I 1–375（375 aa） Chain J 1–375（375 aa） Chain K 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8IB2 Structure of mammalian spectrin-actin junctional complex of membrane skeleton, Pointed-end segment, headpiece domain of dematin optimized Deposited 2023-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–375（375 aa） Chain C 1–375（375 aa） Chain D 1–375（375 aa） Chain E 1–375（375 aa） Chain F 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8P94 Cryo-EM structure of cortactin stabilized Arp2/3-complex nucleated actin branches Deposited 2023-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain H 1–375（375 aa） Chain J 1–375（375 aa） Chain K 1–375（375 aa） Chain N 1–375（375 aa） Chain O 1–375（375 aa） Chain P 1–375（375 aa） Chain Q 1–375（375 aa） Chain R 1–375（375 aa） Chain S 1–375（375 aa） Chain W 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 12 MG MAGNESIUM ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES pH 7.5, 50mM KCl, 1mM EGTA, 1mM MgCl2, 0.2 mM ATP and 1 mM DTT cryo-EM vitrification conditions Cryogen ETHANE；Back blotting	Resolution 3.30 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9DGR Composite structure of dynein-dynactin on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain H 1–375（375 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.00 Å
9DGS Dynactin and dynein tail region of dynein-dynactin complex on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9DGT structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.20 Å
9DGU structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9DGV structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.80 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å
9I2B SPIN90-Arp2/3 nucleated bidirectional actin filaments Deposited 2025-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain I 1–375（375 aa） Chain J 1–375（375 aa） Chain S 1–375（375 aa） Chain T 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 MG MAGNESIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9YNG Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the presence of LIS1 Deposited 2025-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain H 1–375（375 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å

24 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACTB_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–370； UniProt 6–375

ACTIN RELATED PROTEIN 11

OrganismNot specified

UniProt I3LHK5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain J； UniProt 1–417	Not recorded	ACTIN RELATED PROTEIN 1 × 8 （F2Z5G5） ACTIN, CYTOPLASMIC 1 × 1 （Q6QAQ1） CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1 × 1 （A0PFK5） F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II × 1 （D2JYW4） DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 3 × 2 DYNACTIN SUBUNIT 2 × 2 DYNACTIN 5 × 1 （D0G6S1） DYNACTIN SUBUNIT 6 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 2 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1	ELECTRON MICROSCOPY cryo-EM buffer：50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions：Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5ADX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 12–390（379 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
5NW4 Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2 Deposited 2017-05-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain X 1–417（417 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–390（390 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–390（390 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain J 1–390（390 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6ZNM The pointed end complex of dynactin bound to BICDR1 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6ZNN The pointed end complex of dynactin bound to Hook3 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6ZNO The pointed end complex of dynactin with the p150 projection docked Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
6ZO4 The pointed end complex of dynactin bound to BICD2 Deposited 2020-07-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8M The pointed end complex of dynactin bound to BICDR1 Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain J 1–417（417 aa）	Not recorded	ZN ZINC ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.37 Å
8PR4 Dynactin pointed end bound to JIP3 Deposited 2023-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain J 1–417（417 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9DGR Composite structure of dynein-dynactin on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain J 1–417（417 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.00 Å
9DGS Dynactin and dynein tail region of dynein-dynactin complex on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9DGT structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.20 Å
9DGU structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9DGV structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.80 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å
9YNG Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the presence of LIS1 Deposited 2025-10-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain J 1–417（417 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LHK5_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–417； UniProt 1–417

CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1

OrganismNot specified

UniProt A0PFK5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain K； UniProt 7–281	Not recorded	ACTIN RELATED PROTEIN 1 × 8 （F2Z5G5） ACTIN, CYTOPLASMIC 1 × 1 （Q6QAQ1） ACTIN RELATED PROTEIN 11 × 1 （I3LHK5） F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II × 1 （D2JYW4） DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 3 × 2 DYNACTIN SUBUNIT 2 × 2 DYNACTIN 5 × 1 （D0G6S1） DYNACTIN SUBUNIT 6 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 2 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1	ELECTRON MICROSCOPY cryo-EM buffer：50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions：Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5ADX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain K 7–281（275 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
5NW4 Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2 Deposited 2017-05-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain Y 1–286（286 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F1U N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1 Deposited 2017-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8I The barbed end complex of dynactin bound to BICDR1 and the cytoplasmic dynein tails (A2, B1, B2) Deposited 2022-03-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.30 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9DGR Composite structure of dynein-dynactin on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain K 1–286（286 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.00 Å
9DGS Dynactin and dynein tail region of dynein-dynactin complex on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9DGT structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.20 Å
9DGU structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9DGV structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules Deposited 2024-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.80 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å
9YNG Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the presence of LIS1 Deposited 2025-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain K 1–286（286 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å

17 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0PFK5_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–275； UniProt 7–281

F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II

OrganismNot specified

UniProt D2JYW4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain L； UniProt 2–271	Not recorded	ACTIN RELATED PROTEIN 1 × 8 （F2Z5G5） ACTIN, CYTOPLASMIC 1 × 1 （Q6QAQ1） ACTIN RELATED PROTEIN 11 × 1 （I3LHK5） CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1 × 1 （A0PFK5） DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 3 × 2 DYNACTIN SUBUNIT 2 × 2 DYNACTIN 5 × 1 （D0G6S1） DYNACTIN SUBUNIT 6 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 2 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1	ELECTRON MICROSCOPY cryo-EM buffer：50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions：Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5ADX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5AFU Cryo-EM structure of dynein tail-dynactin-BICD2N complex Deposited 2015-01-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain L 2–271（270 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT；pH 7.4；150MM KCL, 25MM HEPES-KOH, 1MM MGCL2, 0.1MM MGATP, 5MM DTT cryo-EM vitrification conditions Cryogen ETHANE；LIQUID ETHANE	Resolution 8.20 Å
5NW4 Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2 Deposited 2017-05-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain Z 2–277（276 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	D2JYW4_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–270； UniProt 2–271

DYNACTIN 5

OrganismNot specified

UniProt D0G6S1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain U； UniProt 1–190	Not recorded	ACTIN RELATED PROTEIN 1 × 8 （F2Z5G5） ACTIN, CYTOPLASMIC 1 × 1 （Q6QAQ1） ACTIN RELATED PROTEIN 11 × 1 （I3LHK5） CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1 × 1 （A0PFK5） F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II × 1 （D2JYW4） DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 3 × 2 DYNACTIN SUBUNIT 2 × 2 DYNACTIN SUBUNIT 6 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 2 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1 DYNACTIN SUBUNIT 2 × 1	ELECTRON MICROSCOPY cryo-EM buffer：50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT；pH 6.5；50MM KCL, 25MM K2HPO4- KH2PO4, 1MM MGCL2,5MM DTT cryo-EM vitrification conditions：Cryogen ETHANE；LIQUID ENTHANE	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5ADX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5NW4 Human cytoplasmic dynein-1 bound to dynactin and an N-terminal construct of BICD2 Deposited 2017-05-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain g 1–190（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
6F1T Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1 Deposited 2017-11-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6F38 Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3 Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6F3A Cryo-EM structure of a single dynein tail domain bound to dynactin and BICD2N Deposited 2017-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
6ZNL Cryo-EM structure of the dynactin complex Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6ZNM The pointed end complex of dynactin bound to BICDR1 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6ZNN The pointed end complex of dynactin bound to Hook3 Deposited 2020-07-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6ZNO The pointed end complex of dynactin with the p150 projection docked Deposited 2020-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain U 8–174（167 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
6ZO4 The pointed end complex of dynactin bound to BICD2 Deposited 2020-07-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å
7Z8F Composite structure of dynein-dynactin-BICDR on microtubules Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 13 MG MAGNESIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ZN ZINC ION × 3 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 20.00 Å
7Z8M The pointed end complex of dynactin bound to BICDR1 Deposited 2022-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain U 1–190（190 aa）	Not recorded	ZN ZINC ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；20 second incubation	Resolution 3.37 Å
8PR4 Dynactin pointed end bound to JIP3 Deposited 2023-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain U 1–190（190 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8PTK Composite structure of Dynein-Dynactin-JIP3-LIS1 Deposited 2023-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 16 ATP ADENOSINE-5'-TRIPHOSPHATE × 6 ZN ZINC ION × 3 MG MAGNESIUM ION × 6 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
9DGR Composite structure of dynein-dynactin on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain U 1–190（190 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 15.00 Å
9DGS Dynactin and dynein tail region of dynein-dynactin complex on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9DGT structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.20 Å
9DGU structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
9DGV structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules Deposited 2024-09-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.80 Å
9HHL Structure of Dynein-Dynactin-NuMA-LIS1 Deposited 2024-11-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 41 PDB declaration: 41-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.53 Å
9YNG Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the presence of LIS1 Deposited 2025-10-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain U 1–190（190 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.07 Å

20 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	D0G6S1_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–189； UniProt 1–190

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5adx
Deposition date deposition_date	2015-08-24
Structure title title	CryoEM structure of dynactin complex at 4.0 angstrom resolution
Keywords keywords	STRUCTURAL PROTEIN, DYNEIN CO-FACTOR, ACTIN-LIKE FILAMENT, CELLULAR CARGO TRANSPORT; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	98.41 Å
Radius of gyration Rg (electron density) rg_electron	99.99 Å
Forward intensity I(0) i0	7419020000.00
Molecular weight molecular_weight	697960.0 kDa
Excluded volume excluded_volume	858580 Å³
Envelope volume envelope_volume	1715300 Å³
Hydration-shell volume shell_volume	161130 Å³
Envelope diameter envelope_diameter	381.8 Å
Shell Rg shell_rg	72.05 Å
Envelope Rg envelope_rg	100.20 Å
Shape Rg shape_rg	100.10 Å
Total Rg total_rg	99.28 Å
Total atoms total_atoms	49392
Residues n_residues	7306
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	273.0 Å
Rg (real space) rg_real	91.84 Å
Rg uncertainty (real space) rg_real_error	1.43 Å
I(0) (real space) i0_real	7.0830e+09
I(0) uncertainty (real space) i0_real_error	1.5290e+08
Rg (reciprocal space) rg_reciprocal	89.69 Å
I(0) (reciprocal space) i0_reciprocal	7213000000.0000
Solution quality estimate total_estimate	0.9097
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	68.2 Å
Skewness Skewness skewness	0.411
Kurtosis Kurtosis kurtosis	-0.678
Angular range angular_range	— – 0.0800 Å⁻¹
Current regularization parameter α current_alpha	0.7685
Highest regularization parameter α highest_alpha	241500000.0000
Real-space data points n_real_points	17
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.014; Oscil: 0.966; Stabil: 0.978; Sysdev: 1.000; Positv: 1.000; Valcen: 0.994; Smooth: 0.002

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	ACTIN RELATED PROTEIN 1
Molecular weight formula_weight	41959.9 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,I
Atom count atom_count	49392

IANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 2 Entity 2 polymer

Description description	ACTIN, CYTOPLASMIC 1
Molecular weight formula_weight	41193.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 3 Entity 3 polymer

Description description	ACTIN RELATED PROTEIN 11
Molecular weight formula_weight	46250.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERPSPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Entity 4 Entity 4 polymer

Description description	CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1
Molecular weight formula_weight	31777.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

RVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSWRESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGK

Entity 5 Entity 5 polymer

Description description	F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II
Molecular weight formula_weight	30509.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI

Entity 6 Entity 6 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	70144.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 7 Entity 7 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	69633.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

Entity 8 Entity 8 polymer

Description description	DYNACTIN SUBUNIT 3
Molecular weight formula_weight	7507.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 9 Entity 9 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	7762.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	DYNACTIN 5
Molecular weight formula_weight	20703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 11 Entity 11 polymer

Description description	DYNACTIN SUBUNIT 6
Molecular weight formula_weight	18164.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

SGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 12 Entity 12 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	20698.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

Entity 13 Entity 13 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	35676.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

Entity 14 Entity 14 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	5400.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MADPKYADLPGIARNEPDVYLEELTSTSVEHAIVNPNAAYDKFKDKRV

Entity 15 Entity 15 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	7931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MADPKYADLPGIARNEPDVYLEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGE

Entity 16 Entity 16 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	3173.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MADPKYADLPGIARNEPDVYXXXXXXXXXXX

Entity 17 Entity 17 polymer

Description description	DYNACTIN SUBUNIT 2
Molecular weight formula_weight	2237.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MADPKYADLPGIARNEPDVY

▼

7. Fold Classification (SCOP + CATH) 34 domains

CATH v4.4 (34 domains)

Domain ID domain_id	5adxA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxA03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxB03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxC02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxC03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxD03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxE03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxF03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxG02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxG03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxH01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxH02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxH03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxI01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxI02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	5adxI03
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxJ01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

Domain ID domain_id	5adxK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	5adxK02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	5adxL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	5adxL02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	5adxU00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	10 — Hexapeptide repeat proteins

Domain ID domain_id	5adxV00
Class class	2 — Mainly Beta
Architecture architecture	160 — 3 Solenoid
Topology topology	10 — UDP N-Acetylglucosamine Acyltransferase; domain 1
Homologous superfamily homologous superfamily	10 — Hexapeptide repeat proteins

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	115044

fit	/app/data/saxs_computation/ad/5adx/5adx.fit
pddf	/app/data/pr_computation/ad/5adx/5adx.pr.out
profile	/app/data/saxs_computation/ad/5adx/5adx.dat

CryoEM structure of dynactin complex at 4.0 angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

ACTIN RELATED PROTEIN 1

State in the Current Structure

Other States of the Same Protein in the Database

ACTIN, CYTOPLASMIC 1

State in the Current Structure

Other States of the Same Protein in the Database

ACTIN RELATED PROTEIN 11

State in the Current Structure

Other States of the Same Protein in the Database

CAPPING PROTEIN (ACTIN FILAMENT) MUSCLE Z-LINE, ALPHA 1

State in the Current Structure

Other States of the Same Protein in the Database

F-ACTIN CAPPING PROTEIN BETA SUBUNIT VARIANT II

State in the Current Structure

Other States of the Same Protein in the Database

DYNACTIN 5

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

Entity 15 Entity 15 polymer

Polymer Polymer

Entity 16 Entity 16 polymer

Polymer Polymer

Entity 17 Entity 17 polymer

Polymer Polymer

7. Fold Classification (SCOP + CATH) 34 domains

CATH v4.4 (34 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)